Protein

MCA_06176_1

Length
173 amino acids


Description: Putative NADH-ubiquinone oxidoreductase subunit

Browser: contigD:3460803-3461441+

RNA-seq: read pairs 10018, FPKM 711.4, percentile rank 95.5% (100% = highest expression)

Protein function

Annotation:Putative NADH-ubiquinone oxidoreductase subunit
KEGG:K03937NDUFS4 NADH dehydrogenase (ubiquinone) Fe-S protein 4
EGGNOG:0PMWVFG02474.1NADH-ubiquinone oxidoreductase 21 kDa subunit
CGD closest match:CAL0000190677orf19.3290Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_06408_178.26%1618e-94MIA_06408_1
A0A0J9X9Q9_GEOCN62.42%1571e-69NUYM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA07s00098g PE=4 SV=1
Q6CEK9_YARLI60.69%1738e-67YALI0B14861p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B14861g PE=4 SV=1
UniRef50_Q6CEK960.69%1732e-63YALI0B14861p n=14 Tax=Saccharomycetales TaxID=4892 RepID=Q6CEK9_YARLI
A0A060T6S1_BLAAD58.71%1553e-64ARAD1C15994p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C15994g PE=4 SV=1
A0A1D8PCD3_CANAL63.87%1198e-56Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3290 PE=4 SV=1
A0A1E4TC60_9ASCO52.42%1241e-43Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3970 PE=4 SV=1
A0A161HIK5_9ASCO33.72%863e-09Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_607 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9623
Predicted cleavage: 35

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_06176_1
MLNRSLLQARAALYATRPALLTSTRAFSAMPVRFNKQQQTSPDVLEESESYTPAEVVSGAPAELAINRIVRIYQAAKPAT
QSGSWGTRVWRIDWDIVDRANRWENDLIGYASSGDYMQGTEIKFNSKEAAVRFAKNQGWDYYIQEPHVRKFRVKSYSTNF
EHSPGKLKHIRTK

GO term prediction

Biological Process

GO:0022900 electron transport chain

Molecular Function

GO:0016651 oxidoreductase activity, acting on NAD(P)H

Cellular Component

None predicted.