Protein
MCA_06103_1
Length
67 amino acids
Browser: contigD:3249163-3249367-
RNA-seq: read pairs 1379, FPKM 250.6, percentile rank 90.4% (100% = highest expression)
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_A0A0H5C214 | 47.54% | 61 | 2e-09 | Uncharacterized protein n=1 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C214_CYBJA |
MIA_03657_1 | 53.33% | 60 | 5e-14 | MIA_03657_1 |
A0A167CVY6_9ASCO | 48.15% | 54 | 3e-11 | GTP-binding protein OS=Sugiyamaella lignohabitans GN=AWJ20_408 PE=4 SV=1 |
A0A0J9X674_GEOCN | 41.94% | 62 | 1e-08 | Similar to Yarrowia lipolytica YALI0D10725g [Yarrowia lipolytica CLIB 122] OS=Geotrichum candidum GN=BN980_GECA02s08623g PE=4 SV=1 |
Q6C9J5_YARLI | 44.23% | 52 | 4e-07 | YALI0D10725p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10725g PE=4 SV=1 |
A0A1E3PR05_9ASCO | 39.34% | 61 | 5e-07 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_80892 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1462
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_06103_1 MSDNKEFKATVMPREDTEQKSGPNGLPGIQIPANAHEIKEFQEVNNMSAKELNAQMEAELKKKSESK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.