Protein

MCA_06099_1

Length
105 amino acids


Browser: contigD:3242820-3243533-

RNA-seq: read pairs 44559, FPKM 5194.1, percentile rank 99.7% (100% = highest expression)

Protein function

KEGG:K02917RP-L35Ae large subunit ribosomal protein L35Ae
EGGNOG:0PPN6FG01278.160s ribosomal protein
SGD closest match:S000005760RPL33B60S ribosomal protein L33-B
CGD closest match:CAL0000183633orf19.6882.1Ribosomal 60S subunit protein L33A

Protein alignments

%idAln lengthE-value
MIA_03660_183.81%1051e-63MIA_03660_1
A0A060T7W6_BLAAD78.85%1041e-58ARAD1C25278p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25278g PE=4 SV=1
A0A0J9XBX7_GEOCN74.04%1045e-56Similar to Saccharomyces cerevisiae YPL143W RPL33A Ribosomal 60S subunit protein L33A OS=Geotrichum candidum GN=BN980_GECA08s03200g PE=4 SV=1
A0A1D8PHH4_CANAL74.04%1043e-56Ribosomal 60S subunit protein L33A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6882.1 PE=4 SV=1
RL33B_YEAST72.12%1041e-5460S ribosomal protein L33-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL33B PE=1 SV=2
UniRef50_P0574471.15%1047e-5160S ribosomal protein L33-A n=52 Tax=saccharomyceta TaxID=716545 RepID=RL33A_YEAST
Q6BZR8_YARLI71.15%1049e-54YALI0F31405p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31405g PE=4 SV=2
A0A1E3PGJ8_9ASCO66.35%1041e-51Ribosomal protein L35Ae OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47204 PE=4 SV=1
A0A1E4TLY8_9ASCO54.90%1022e-40Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30753 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3829

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 100 105

Detailed signature matches

    1. PF01247 (Ribosomal_...)
    1. SSF50447 (Translati...)
    1. PS01105 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_06099_1
MTDRLYVKGKHVSYQRSKHVTHPATSLIKIEGVTSPKEAEFYLGKRVAYVYRANKEVKGTKIRVMWGKITRSHGNSGIVR
AKFKKNLPPNTLGSTVRVMLYPSNI

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome