Protein

MCA_06046_1

Length
199 amino acids

Gene name: ISU1

Description: Iron sulfur cluster assembly protein 1, mitochondrial

Browser: contigD:3105791-3106391-

RNA-seq: read pairs 3824, FPKM 236.2, percentile rank 89.9% (100% = highest expression)

Protein function

Annotation:ISU1Iron sulfur cluster assembly protein 1, mitochondrial
EGGNOG:0PNQYISU1Iron sulfur cluster assembly protein
SGD closest match:S000005752ISU2Iron sulfur cluster assembly protein 2, mitochondrial
CGD closest match:CAL0000192594ISU1Iron-sulfur cluster assembly protein

Protein alignments

%idAln lengthE-value
MIA_03383_192.65%1363e-88MIA_03383_1
A0A0J9XKA2_GEOCN88.97%1362e-84Iron-sulfur cluster assembly protein OS=Geotrichum candidum GN=BN980_GECA32s02485g PE=3 SV=1
A0A1E3PJ31_9ASCO90.62%1281e-82Iron-sulfur cluster assembly protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83073 PE=3 SV=1
A0A167EH57_9ASCO85.29%1363e-82Iron-sulfur cluster assembly protein OS=Sugiyamaella lignohabitans GN=ISU1 PE=3 SV=1
A0A060T872_BLAAD85.29%1368e-81Iron-sulfur cluster assembly protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04642g PE=3 SV=1
ISU1_YARLI86.57%1342e-79Iron sulfur cluster assembly protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ISU1 PE=3 SV=1
UniRef50_Q6CFQ086.57%1344e-76Iron sulfur cluster assembly protein 1, mitochondrial n=89 Tax=Eukaryota TaxID=2759 RepID=ISU1_YARLI
A0A1E4TA41_9ASCO77.37%1375e-74Iron-sulfur cluster assembly protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57823 PE=3 SV=1
Q5AGZ0_CANAL76.30%1352e-70Iron-sulfur cluster assembly protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISU1 PE=3 SV=1
ISU2_YEAST80.00%1254e-68Iron sulfur cluster assembly protein 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISU2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9878
Predicted cleavage: 59

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 199

Detailed signature matches

  1. Family IPR011339
    ISC system FeS cluster assembly, IscU scaffold
    1. TIGR01999
  2. Domain IPR002871
    NIF system FeS cluster assembly, NifU, N-terminal
    1. PF01592 (NifU_N)
    2. cd06664 (IscU_like)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.10...
  2. SSF82649 (SufE/NifU)

Residue annotation

  1. trimerization site...
  2. active site cd06664

Protein sequence

>MCA_06046_1
MSIFKFSRNSVLRTVSSSSSMIRPSTISSTSFITPSSSLLLSRSYHAKVLDHYNNPRNVGSMNKNDTDVGTGLVGAPACG
DVMKLQIRVDDNGIISDVKFKTFGCGSAIASSSYVTELVRGMSIEEAGKIKNTTIAKELSLPPVKLHCSMLAEDAIKSAI
KDYQKKTGKKRTVTLGPDAAATAANNTANASAQKSTTSA

GO term prediction

Biological Process

GO:0016226 iron-sulfur cluster assembly

Molecular Function

GO:0005506 iron ion binding
GO:0051536 iron-sulfur cluster binding

Cellular Component

None predicted.