Protein

MCA_06026_1

Length
433 amino acids

Browser: contigD:3063066-3064368-

RNA-seq: read pairs 535, FPKM 15.2, percentile rank 34.5% (100% = highest expression)

Protein function

KEGG:K01855PUS3 tRNA pseudouridine38/39 synthase [EC:5.4.99.45]
EGGNOG:0PIEKFG10837.1tRNA pseudouridine synthase
SGD closest match:S000001895DEG1tRNA pseudouridine(38/39) synthase
CGD closest match:CAL0000197135orf19.6297tRNA pseudouridine synthase

Protein alignments

%idAln lengthE-value
A0A0J9XHL0_GEOCN58.35%4252e-166tRNA pseudouridine synthase OS=Geotrichum candidum GN=BN980_GECA15s01154g PE=3 SV=1
MIA_05071_158.85%4181e-158MIA_05071_1
A0A161HLD6_9ASCO56.45%3721e-135tRNA pseudouridine synthase OS=Sugiyamaella lignohabitans GN=DEG1 PE=3 SV=1
UniRef50_A0A161HLD656.45%3723e-132tRNA pseudouridine synthase n=2 Tax=Trichomonascaceae TaxID=410830 RepID=A0A161HLD6_9ASCO
A0A060T5Q1_BLAAD49.76%4209e-136tRNA pseudouridine synthase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06666g PE=3 SV=1
PUS3_YEAST53.94%3306e-117tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1
Q6C194_YARLI45.15%4236e-117tRNA pseudouridine synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F18216g PE=3 SV=1
A0A1E3PHT1_9ASCO50.86%3504e-117tRNA pseudouridine synthase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_6964 PE=3 SV=1
A0A1E4TEU1_9ASCO46.70%4245e-116tRNA pseudouridine synthase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_104682 PE=3 SV=1
Q59N30_CANAL47.72%4172e-114tRNA pseudouridine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6297 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0113

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 433

Detailed signature matches

  1. Family IPR001406
    Pseudouridine synthase I, TruA
    1. TIGR00071
    2. MF_00171 (TruA)
  2. Domain IPR020103
    Pseudouridine synthase, catalytic domain
    1. SSF55120 (Pseudouri...)
  3. Domain IPR020097
    Pseudouridine synthase I, TruA, alpha/beta domain
    1. PF01416 (PseudoU_sy...)
  4. Domain IPR020095
    Pseudouridine synthase I, TruA, C-terminal
    1. G3DSA:3.30.70...
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. cd02569 (PseudoU_sy...)
  3. mobidb-lite (disord...)

Residue annotation

  1. probable active si...

Protein sequence

>MCA_06026_1
MSETSANLVPMDIDPSEFDYTKWSKGDLITRIKSLEQQIGNPSTPKRKKVFDFSKFTTRHVAIRFAYLGWNYSGLAVQLN
SPNLETVEGHILDCMYKAKLIPTRNPQDCNFSRCGRTDKGVSAFKQVISLNVRSVLSLEDQKNPEKDEEELDYLHILNQI
LPEDIRLYEICLQPPPDFDARFSCSYRRYKYFFHYKGPEHLNLEEMQRAATMFEGEHDFRNFCKVDPSKQITNFRRNIDQ
AMIIPANNHQAEGLYCVDLRGKAFLWHQVRSMVAVLLLVGQGLEPAEIVRDLLDVEKYPGKPIYEMAADIPLVLWDCGFP
DNMVWKSFKHQDSLERLQNRLYASWHGHLMRCSMSQHMMEAVLSYVQPPYSKEFANYKKPANRVVVNLGNGVGKNLAKYV
PLAKRKTMDSPEVVNEKWLKKNPRAQPEQSFTE

GO term prediction

Biological Process

GO:0001522 pseudouridine synthesis
GO:0009451 RNA modification

Molecular Function

GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity

Cellular Component

None predicted.