Protein

MCA_05974_1

Length
77 amino acids


Browser: contigD:2912793-2913241-

RNA-seq: read pairs 596, FPKM 94.4, percentile rank 77.7% (100% = highest expression)

Protein function

EGGNOG:0PRZ5FG01232.1integral membrane protein required for ER to Golgi transport
SGD closest match:S000007651YOS1Protein transport protein YOS1
CGD closest match:CAL0000179899orf19.5825.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_02093_178.12%642e-29MIA_02093_1
A0A0J9X451_GEOCN65.62%643e-21Similar to Saccharomyces cerevisiae YER074W-A YOS1 Integral membrane protein required for ER to Golgi transport OS=Geotrichum candidum GN=BN980_GECA01s07561g PE=4 SV=1
UniRef50_A0A0J9X45165.62%646e-18Similar to Saccharomyces cerevisiae YER074W-A YOS1 Integral membrane protein required for ER to Golgi transport n=3 Tax=Dikarya TaxID=451864 RepID=A0A0J9X451_GEOCN
A0A1D8PGP8_CANAL53.09%811e-18Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5825.1 PE=4 SV=1
A0A1E3PRD6_9ASCO57.35%682e-18Yos1-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21638 PE=4 SV=1
YOS1_YEAST47.06%688e-15Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0310

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF08571 (Yos1)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05974_1
MFGLLYYVVVLLLNAVAILSEDRFIARIGWGSGQVYGVQDDSIQTKLLNLIRATRTVMRPPLIAFNISIILYELILG

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.