Protein
MCA_05940_1
Length
307 amino acids
Gene name: PIL1B
Description: Sphingolipid long chain base-responsive protein PIL1; Eisosome core component; detected in phosphorylated state in mitochondria
Browser: contigD:2814452-2816312-
RNA-seq: read pairs 37087, FPKM 1487.8, percentile rank 97.3% (100% = highest expression)
Protein function
Annotation: | PIL1B | Sphingolipid long chain base-responsive protein PIL1; Eisosome core component; detected in phosphorylated state in mitochondria | |
---|---|---|---|
EGGNOG: | 0PFSH | FG00900.1 | sphingolipid long chain base-responsive protein |
SGD closest match: | S000003318 | PIL1 | Sphingolipid long chain base-responsive protein PIL1 |
CGD closest match: | CAL0000186520 | LSP1 | Lipid-binding protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05712_1 | 93.91% | 279 | 7e-174 | MIA_05712_1 |
Q6CC94_YARLI | 90.25% | 277 | 7e-167 | YALI0C11341p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C11341g PE=4 SV=1 |
A0A167FXX6_9ASCO | 89.44% | 284 | 2e-166 | Lipid-binding protein PIL1 OS=Sugiyamaella lignohabitans GN=PIL1 PE=4 SV=1 |
A0A060SWT9_BLAAD | 88.93% | 280 | 6e-166 | ARAD1A08008p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08008g PE=4 SV=1 |
A0A0J9X4F0_GEOCN | 89.89% | 277 | 1e-164 | Similar to Saccharomyces cerevisiae YGR086C PIL1 Primary component of eisosomess, which are large immobile cell cortex structures associated with endocytosis OS=Geotrichum candidum GN=BN980_GECA02s04564g PE=4 SV=1 |
A0A1E3PR35_9ASCO | 87.41% | 278 | 6e-165 | Putative sphingolipid long chain base-responsive protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40564 PE=4 SV=1 |
A0A1E4TF81_9ASCO | 82.01% | 278 | 3e-154 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31398 PE=4 SV=1 |
Q59KV8_CANAL | 78.57% | 280 | 2e-146 | Lipid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LSP1 PE=4 SV=1 |
PIL1_YEAST | 80.87% | 277 | 3e-142 | Sphingolipid long chain base-responsive protein PIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIL1 PE=1 SV=1 |
UniRef50_P53252 | 80.87% | 277 | 7e-139 | Sphingolipid long chain base-responsive protein PIL1 n=120 Tax=saccharomyceta TaxID=716545 RepID=PIL1_YEAST |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9581
Predicted cleavage: 47
Protein family membership
- Eisosome component PIL1/LSP1 (IPR028245)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05940_1 MHRTYSLRNSRAPTASQLQSPPPPPSTTKSGRFFGKGSLAHSFRRSTAGSMGPELARKLAQLVKMEKNVMRSVELVARER REVAKQLSAWGEDADDDVSDVTDRLGVLIYEIGELEDQFIDKYDQYRITLKAIRNIEASVQPSRDRKQKITDSIAHLKYK EPNSPKIVVLEQELVRAEAESLVAEAQLSNITRDKLKAAFNYQFDAIREHSEKLALIAGYGKALLELLDDTPVTPGETRP SYDGYEASKQIIIDCENALASWTLDQATIKPTLSIRRADESYLEDEAEEEEHHQQQQEQHEREAELA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.