Protein

MCA_05918_1

Length
275 amino acids

Browser: contigD:2764568-2765571-

RNA-seq: read pairs 2206, FPKM 98.8, percentile rank 78.5% (100% = highest expression)

Protein function

EGGNOG:0PGA4FG07024.1RAS small monomeric GTPase
SGD closest match:S000003384RSR1Ras-related protein RSR1

Protein alignments

%idAln lengthE-value
MIA_00704_180.22%1824e-108MIA_00704_1
A0A0J9XH71_GEOCN77.22%1802e-99Similar to Saccharomyces cerevisiae YFL038C YPT1 Rab family GTPase OS=Geotrichum candidum GN=BN980_GECA16s01528g PE=4 SV=1
A0A060TCV4_BLAAD75.98%1795e-98ARAD1D46090p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46090g PE=4 SV=1
F2Z6A9_YARLI64.04%1783e-85YALI0E29887p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E29887g PE=4 SV=1
UniRef50_F2Z6A964.04%1787e-82YALI0E29887p n=5 Tax=Saccharomycetales TaxID=4892 RepID=F2Z6A9_YARLI
A0A1E3PNQ4_9ASCO63.01%1731e-79Ras-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82551 PE=4 SV=1
A0A167F5S3_9ASCO75.89%1123e-56Ras family GTPase RAS2 OS=Sugiyamaella lignohabitans GN=RAS2 PE=4 SV=1
A0A1E4TBI2_9ASCO45.00%1604e-41Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_132871 PE=4 SV=1
RAS1_CANAL43.48%1611e-35Ras-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAS1 PE=3 SV=2
RSR1_YEAST40.46%1732e-32Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0098

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 275

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR020849
    Small GTPase superfamily, Ras type
    1. PS51421 (RAS)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. SM00173 (ras_sub_4)
  5. SM00174 (rho_sub_3)
  6. SM00175 (rab_sub_5)
  7. cd00876 (Ras)
  8. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd00876
  2. GDI interaction si...
  3. GTP/Mg2+ binding s...
  4. GEF interaction si...
  5. Switch I region cd...
  6. G2 box cd00876
  7. effector interacti...
  8. G3 box cd00876
  9. Switch II region c...
  10. G4 box cd00876
  11. G5 box cd00876

Protein sequence

>MCA_05918_1
MSTENDKITVVILGDGGTGKSCITMSLIRSKWVEEYDPTIEDSYTTSRTVDGKTYRLDIIDTAGQEEYRDMLGSLFSAES
SIDAYLLVYDITSQTSLENLEYFDELIEKTLESGIRPESSPHPVKIVAGNKCDLSESRTISSEEGLKWANAHGCGFMETS
AKLRVNIEETFEVLIRQVQRNRNQAAGIGANAAAKSSTTGIAQNLKNKSKVSLLSSHSTKDRHNNKEVFGQQQAGGPTSH
NTTAAQPLQNKPHIEKMSEEPGQKKEKKRGCCVIS

GO term prediction

Biological Process

GO:0007165 signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0016020 membrane