Protein
MCA_05902_1
Length
68 amino acids
Browser: contigD:2719127-2719537-
RNA-seq: read pairs 16316, FPKM 2921.8, percentile rank 98.4% (100% = highest expression)
Protein function
KEGG: | K02143 | ATPeFK | F-type H+-transporting ATPase subunit k |
---|---|---|---|
EGGNOG: | 0PTHS | FG05266.1 | Protein of unknown function (DUF2611) |
CGD closest match: | CAL0000179071 | ATP19 | F1F0 ATP synthase subunit k |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X2I7_GEOCN | 69.12% | 68 | 6e-16 | Similar to Saccharomyces cerevisiae YOL077W-A ATP19 Subunit k of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s02303g PE=4 SV=1 |
MIA_03379_1 | 70.00% | 70 | 3e-15 | MIA_03379_1 |
B5FVB3_YARLI | 59.42% | 69 | 5e-12 | YALI0B11913p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B11913g PE=4 SV=1 |
UniRef50_B5FVB3 | 59.42% | 69 | 1e-08 | YALI0B11913p n=16 Tax=Fungi TaxID=4751 RepID=B5FVB3_YARLI |
A0A1E4TH55_9ASCO | 53.62% | 69 | 1e-10 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57423 PE=4 SV=1 |
A0A1D8PFD4_CANAL | 53.03% | 66 | 6e-09 | F1F0 ATP synthase subunit k OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP19 PE=4 SV=1 |
A0A1E3PRJ4_9ASCO | 50.82% | 61 | 2e-08 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48536 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0952
Protein family membership
- ATP synthase subunit K (IPR021278)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF11022 (DUF2611)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_05902_1 MSGPGYVIFGKTFMPHQLAIATLATLTGGILLATSGKKEKPTTPPIQAASADEEDFITQFLKDSEEKK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.