Protein

MCA_05858_1

Length
398 amino acids

Browser: contigD:2567068-2568265+

RNA-seq: read pairs 1540, FPKM 47.7, percentile rank 64.4% (100% = highest expression)

Protein function

KEGG:K12178COPS4 COP9 signalosome complex subunit 4
EGGNOG:0PI81FG00623.1COP9 signalosome complex subunit 4
SGD closest match:S000002306RPN526S proteasome regulatory subunit RPN5
CGD closest match:CAL0000201152RPN5Proteasome regulatory particle lid subunit

Protein alignments

%idAln lengthE-value
MIA_03037_160.36%3913e-173MIA_03037_1
A0A0J9X8A7_GEOCN45.33%3751e-113Similar to Saccharomyces cerevisiae YDL147W RPN5 Subunit of the COP9 signalosome (CSN) and non-ATPase regulatory subunit of the 26S proteasome lid OS=Geotrichum candidum GN=BN980_GECA05s00846g PE=4 SV=1
UniRef50_A0A0J9X8A745.33%3753e-110Similar to Saccharomyces cerevisiae YDL147W RPN5 Subunit of the COP9 signalosome (CSN) and non-ATPase regulatory subunit of the 26S proteasome lid n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X8A7_GEOCN
A0A1E3PI23_9ASCO36.00%4002e-83Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83157 PE=4 SV=1
A0A167DM58_9ASCO38.19%3649e-79Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1339 PE=4 SV=1
Q6C7V0_YARLI38.01%3713e-77YALI0D25146p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25146g PE=4 SV=1
A0A060SYI8_BLAAD33.26%4271e-73ARAD1A16962p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A16962g PE=4 SV=1
A0A1E4TDW0_9ASCO25.37%2016e-15Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31025 PE=4 SV=1
RPN5_YEAST25.66%2263e-0926S proteasome regulatory subunit RPN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN5 PE=1 SV=3
A0A1D8PP77_CANAL23.12%1995e-07Proteasome regulatory particle lid subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPN5 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4408

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 398

Detailed signature matches

  1. Domain IPR000717
    Proteasome component (PCI) domain
    1. SM00088 (PINT_4)
    2. PF01399 (PCI)
  2. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. G3DSA:1.10.10.10
    2. SSF46785 ("Winged h...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SM00753 (PINT)

Protein sequence

>MCA_05858_1
MTTPSISREVERLTDLNIDGSTDFKADKYLEILTQTSFTIDNIREFVVAVINIPYGTAIIREVLNKLIALLQNKGLNWQD
EETILLFLLDKISPMIMSYEDQDVAARLRLADLYEQNDENIKASTILEQGVTRRVLKDESRFEWYIRIVRNRLEVDDSTS
AEGFIKRAALLRPKLKAIDPSLQIHFLFSQARIADSNRNFVDAARKYYEVSIKPDVDPAEQMACLESAITCVILAPAGPM
RNQILLLIFNDDRTQSFPEYEILKKLYTNRLLMNDELKNFESKLLPHQKASLADGLTVLRRSMIDHNLVAVSRIYSSISI
EQLGKLLGLDSSQVEDYAGKMILQGRLAAAIDQVYEIVQFKRQDDINNLRRWESKIKTMCSDLDHLVNDITRLQNSKA

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.