Protein

MCA_05840_1

Length
287 amino acids


Gene name: CYT1

Description: Cytochrome c1, heme protein, mitochondrial

Browser: contigD:2513465-2515002-

RNA-seq: read pairs 36969, FPKM 1586.1, percentile rank 97.4% (100% = highest expression)

Protein function

Annotation:CYT1Cytochrome c1, heme protein, mitochondrial
KEGG:K00413CYC1 ubiquinol-cytochrome c reductase cytochrome c1 subunit
EGGNOG:0PFPGCYT1Cytochrome c1
SGD closest match:S000005591CYT1Cytochrome c1, heme protein, mitochondrial
CGD closest match:CAL0000192434CYT1Ubiquinol--cytochrome-c reductase catalytic subunit

Protein alignments

%idAln lengthE-value
MIA_06357_187.50%3040.0MIA_06357_1
A0A0J9XH52_GEOCN87.72%2850.0Similar to Saccharomyces cerevisiae YOR065W CYT1 Cytochrome c1 OS=Geotrichum candidum GN=BN980_GECA16s00736g PE=4 SV=1
A0A060T681_BLAAD80.00%2856e-166ARAD1C11836p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11836g PE=4 SV=1
CY1_YEAST73.93%2808e-145Cytochrome c1, heme protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYT1 PE=1 SV=1
UniRef50_P0714373.93%2802e-141Cytochrome c1, heme protein, mitochondrial n=153 Tax=Fungi TaxID=4751 RepID=CY1_YEAST
A0A167CBJ5_9ASCO80.82%2454e-145Ubiquinol--cytochrome-c reductase catalytic subunit CYT1 OS=Sugiyamaella lignohabitans GN=CYT1 PE=4 SV=1
A0A1E4TG49_9ASCO71.90%2742e-143Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_68796 PE=4 SV=1
Q6CGP7_YARLI70.38%2871e-141YALI0A17468p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A17468g PE=4 SV=1
A0A1D8PHA3_CANAL69.20%2898e-138Ubiquinol--cytochrome-c reductase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYT1 PE=4 SV=1
A0A1E3PMG3_9ASCO74.64%2766e-137Cytochrome c1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82295 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4968

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 287

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05840_1
MFKFNVLRQSPRLTKQAIAVSATAVGLSAYYAHLYMTPASATTDAEHGLHAPEFDWPQKGKLSTFDHASLRRGYQVYREV
CAACHSLNLVAWRTLVGVSHTADEVREMAAEFEYDDEPDDEGNPRKRAGKLSDYMPAPYANEQAARAANQGALPPDLSLM
VKARHGGCDYIFSLLTGYPEEPPAGVTLAPGLNYNPYFPGGGIAMGRVLFDGLVEYEDGTPATTSQMAKDVTCFLNWAAE
PEHDERKRAGLKALIILSSLWAISLWVKRWKWAPIKTRKFIYNPPKK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0009055 electron carrier activity
GO:0020037 heme binding

Cellular Component

None predicted.