Protein
MCA_05808_1
Length
432 amino acids
Gene name: DPH1
Description: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1
Browser: contigD:2394075-2395374+
RNA-seq: read pairs 775, FPKM 22.1, percentile rank 44.1% (100% = highest expression)
Protein function
| Annotation: | DPH1 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 | |
|---|---|---|---|
| KEGG: | K07561 | DPH1 | 2-(3-amino-3-carboxypropyl)histidine synthase [EC:2.5.1.108] |
| EGGNOG: | 0PH0C | DPH1 | diphthamide biosynthesis protein 1 |
| SGD closest match: | S000001365 | DPH1 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 |
| CGD closest match: | CAL0000187558 | DPH1 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00779_1 | 78.64% | 440 | 0.0 | MIA_00779_1 |
| A0A0J9XKW6_GEOCN | 70.07% | 431 | 0.0 | Similar to Saccharomyces cerevisiae YIL103W DPH1 Protein required OS=Geotrichum candidum GN=BN980_GECA25s00153g PE=3 SV=1 |
| A0A161HM11_9ASCO | 64.17% | 427 | 0.0 | Dph1p OS=Sugiyamaella lignohabitans GN=DPH1 PE=3 SV=1 |
| A0A1E3PPI6_9ASCO | 61.35% | 445 | 0.0 | Diphthamide biosynthesis protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49656 PE=3 SV=1 |
| A0A060SZQ1_BLAAD | 62.09% | 430 | 0.0 | ARAD1C06248p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06248g PE=3 SV=1 |
| DPH1_YARLI | 60.75% | 428 | 0.0 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH1 PE=3 SV=1 |
| DPH1_YEAST | 59.91% | 434 | 0.0 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH1 PE=1 SV=1 |
| UniRef50_P40487 | 59.91% | 434 | 0.0 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 n=190 Tax=Eukaryota TaxID=2759 RepID=DPH1_YEAST |
| DPH1_CANAL | 59.53% | 425 | 0.0 | 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH1 PE=3 SV=3 |
| A0A1E4TE55_9ASCO | 56.59% | 417 | 6e-166 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31086 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7319
Predicted cleavage: 19
Protein family membership
- Diphthamide synthesis DPH1/DPH2 (IPR016435)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SFLDS00032 (Radical...)
-
-
PF01866 (Diphthamid...)
-
-
-
PIRSF004967 (DPH1)
-
Protein sequence
>MCA_05808_1 MSSNSSTVKPRLRFVGRKSAKAHDSTPVTDVIKNTNDILVTKNDSKKNQRPTRFVSQIPSDILNDDELNAAISILPSNYN FEIHKCVWHIRKQNAKQVALQMPEGLLIYAPIIADILEQFCNVQSIIMGDVTYGACCIDDFTARALGCDFLIHYAHSCLV PVDVTGIKVLYVFVTIDIDVDHFLGTITHHFPAGSRISMVSTIQFNPTLHLVQKQLANYGITVLAPQLMPLSKGEVLGCT SARLKKHDNPEQDDSWDAIVYLGDGRFHLESAMIHNPEIPAYKYDPYSRKFTIEEYDFKELDEIRREAVDQARGGKKVGL ILGSLGRQGNPVTLNMLYQKLRESNKEVFTVVLSEIFPGKLALFQDVDFWVQVACPRLSIDWGYAFPKPLLTPYEAMVAL EQDQDWKKLGYYPMDYYGKEGYGRGKIPSRNI
GO term prediction
Biological Process
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine
Molecular Function
None predicted.
Cellular Component
None predicted.