Protein

MCA_05808_1

Length
432 amino acids

Gene name: DPH1

Description: 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1

Browser: contigD:2394075-2395374+

RNA-seq: read pairs 775, FPKM 22.1, percentile rank 44.1% (100% = highest expression)

Protein function

Annotation:DPH12-(3-amino-3-carboxypropyl)histidine synthase subunit 1
KEGG:K07561DPH1 2-(3-amino-3-carboxypropyl)histidine synthase [EC:2.5.1.108]
EGGNOG:0PH0CDPH1diphthamide biosynthesis protein 1
SGD closest match:S000001365DPH12-(3-amino-3-carboxypropyl)histidine synthase subunit 1
CGD closest match:CAL0000187558DPH12-(3-amino-3-carboxypropyl)histidine synthase subunit 1

Protein alignments

%idAln lengthE-value
MIA_00779_178.64%4400.0MIA_00779_1
A0A0J9XKW6_GEOCN70.07%4310.0Similar to Saccharomyces cerevisiae YIL103W DPH1 Protein required OS=Geotrichum candidum GN=BN980_GECA25s00153g PE=3 SV=1
A0A161HM11_9ASCO64.17%4270.0Dph1p OS=Sugiyamaella lignohabitans GN=DPH1 PE=3 SV=1
A0A1E3PPI6_9ASCO61.35%4450.0Diphthamide biosynthesis protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49656 PE=3 SV=1
A0A060SZQ1_BLAAD62.09%4300.0ARAD1C06248p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06248g PE=3 SV=1
DPH1_YARLI60.75%4280.02-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH1 PE=3 SV=1
DPH1_YEAST59.91%4340.02-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH1 PE=1 SV=1
UniRef50_P4048759.91%4340.02-(3-amino-3-carboxypropyl)histidine synthase subunit 1 n=190 Tax=Eukaryota TaxID=2759 RepID=DPH1_YEAST
DPH1_CANAL59.53%4250.02-(3-amino-3-carboxypropyl)histidine synthase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH1 PE=3 SV=3
A0A1E4TE55_9ASCO56.59%4176e-166Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31086 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7319
Predicted cleavage: 19

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR016435
    Diphthamide synthesis DPH1/DPH2
    1. SFLDS00032 (Radical...)
    2. TIGR00322
    3. PF01866 (Diphthamid...)
  2. Family IPR035435
    Diphthamide synthesis DHP1/DPH2, eukaryotes and archaea
    1. PIRSF004967 (DPH1)

Protein sequence

>MCA_05808_1
MSSNSSTVKPRLRFVGRKSAKAHDSTPVTDVIKNTNDILVTKNDSKKNQRPTRFVSQIPSDILNDDELNAAISILPSNYN
FEIHKCVWHIRKQNAKQVALQMPEGLLIYAPIIADILEQFCNVQSIIMGDVTYGACCIDDFTARALGCDFLIHYAHSCLV
PVDVTGIKVLYVFVTIDIDVDHFLGTITHHFPAGSRISMVSTIQFNPTLHLVQKQLANYGITVLAPQLMPLSKGEVLGCT
SARLKKHDNPEQDDSWDAIVYLGDGRFHLESAMIHNPEIPAYKYDPYSRKFTIEEYDFKELDEIRREAVDQARGGKKVGL
ILGSLGRQGNPVTLNMLYQKLRESNKEVFTVVLSEIFPGKLALFQDVDFWVQVACPRLSIDWGYAFPKPLLTPYEAMVAL
EQDQDWKKLGYYPMDYYGKEGYGRGKIPSRNI

GO term prediction

Biological Process

GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine

Molecular Function

None predicted.

Cellular Component

None predicted.