Protein
MCA_05780_1
Length
345 amino acids
Gene name: GCS1
Description: ADP-ribosylation factor GTPase-activating protein GCS1
Browser: contigD:2312378-2313490+
RNA-seq: read pairs 2706, FPKM 96.6, percentile rank 78.1% (100% = highest expression)
Protein function
| Annotation: | GCS1 | ADP-ribosylation factor GTPase-activating protein GCS1 | |
|---|---|---|---|
| KEGG: | K12492 | ARFGAP1 | ADP-ribosylation factor GTPase-activating protein 1 |
| EGGNOG: | 0PG8M | GCS1 | Zinc finger protein gcs1 |
| SGD closest match: | S000002385 | GCS1 | ADP-ribosylation factor GTPase-activating protein GCS1 |
| CGD closest match: | CAL0000194066 | AGE3 | Age3p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01878_1 | 59.68% | 372 | 7e-152 | MIA_01878_1 |
| A0A0J9X718_GEOCN | 53.71% | 350 | 7e-127 | Similar to Saccharomyces cerevisiae YDL226C GCS1 ADP-ribosylation factor GTPase activating protein (ARF GAP) OS=Geotrichum candidum GN=BN980_GECA04s02859g PE=4 SV=1 |
| A0A167E444_9ASCO | 51.97% | 356 | 3e-123 | Gcs1p OS=Sugiyamaella lignohabitans GN=GCS1 PE=4 SV=1 |
| UniRef50_W1QJ45 | 51.62% | 339 | 2e-115 | Zn finger-containing GTPase-Activating Protein for ARF n=3 Tax=Saccharomycetales TaxID=4892 RepID=W1QJ45_OGAPD |
| A0A060T867_BLAAD | 49.86% | 363 | 9e-107 | ARAD1D04510p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D04510g PE=4 SV=1 |
| A0A1E3PJS1_9ASCO | 44.96% | 367 | 1e-101 | Zn finger-containing GTPase activating protein for ARF OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82684 PE=4 SV=1 |
| A0A1E4TKI3_9ASCO | 44.12% | 340 | 1e-95 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84382 PE=4 SV=1 |
| Q6CD82_YARLI | 50.17% | 287 | 3e-93 | YALI0C02959p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C02959g PE=4 SV=1 |
| A0A1D8PCP6_CANAL | 42.11% | 361 | 3e-93 | Age3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AGE3 PE=4 SV=1 |
| GCS1_YEAST | 46.18% | 314 | 2e-93 | ADP-ribosylation factor GTPase-activating protein GCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCS1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0870
Protein family membership
- Arf GTPase activating protein (IPR001164)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
SSF57863 (ArfGap/Re...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05780_1 MAEWTVDPNNRARLLALQKQGENSKCFDCGAKNPQWASPKFGIFICLDCAGIHRGLGVHISFVRSVTMDQFKPEEMKAME LGGNQKAREWMEGKGLDMSLKPQEKYNTLASYDYKNYLNSLVTNTEYVPLKEVPVSSNRSSDKDESVPTSNRKEAYFSSL GKVNESRPENLPPSKGGKYAGFGNTASSSQPHENSAASVFDNFPNDPLGSLTKGWGIFSKTVSTGLAQVNETYIKPSVKN LAEGDVGQQTRNAMAQFGSKVQETSRLATETFSSLAQNNSQTRTLNNSQYGKLFDGLSEEPLLRTDSPIPPAFGLSRPKE HTALEGIENPEVKKNKKSDWGNDDW
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0005096 GTPase activator activity
Cellular Component
None predicted.