Protein

MCA_05778_1

Length
97 amino acids


Gene name: TIM10

Description: Mitochondrial import inner membrane translocase subunit TIM10

Browser: contigD:2310178-2310576+

RNA-seq: read pairs 1752, FPKM 220.9, percentile rank 89.2% (100% = highest expression)

Protein function

Annotation:TIM10Mitochondrial import inner membrane translocase subunit TIM10
KEGG:K17778TIM10 mitochondrial import inner membrane translocase subunit TIM10
EGGNOG:0PS46TIM10Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space
SGD closest match:S000003530TIM10Mitochondrial import inner membrane translocase subunit TIM10
CGD closest match:CAL0000174336TIM10Protein transporter

Protein alignments

%idAln lengthE-value
MIA_01876_184.85%993e-48MIA_01876_1
A0A0J9XAY8_GEOCN74.65%715e-32Similar to Saccharomyces cerevisiae YHR005C-A TIM10 Essential protein of the mitochondrial intermembrane space OS=Geotrichum candidum GN=BN980_GECA06s03079g PE=3 SV=1
A0A060SVW7_BLAAD73.56%879e-32ARAD1A00726p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00726g PE=3 SV=1
A0A1D8PLH1_CANAL60.22%939e-32Protein transporter OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM10 PE=3 SV=1
TIM10_YEAST60.00%906e-31Mitochondrial import inner membrane translocase subunit TIM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM10 PE=1 SV=1
UniRef50_P8710860.00%901e-27Mitochondrial import inner membrane translocase subunit TIM10 n=52 Tax=Ascomycota TaxID=4890 RepID=TIM10_YEAST
A0A1E4TCM2_9ASCO59.76%822e-28Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32741 PE=3 SV=1
A0A167DY83_9ASCO70.00%801e-27Protein transporter TIM10 OS=Sugiyamaella lignohabitans GN=TIM10 PE=3 SV=1
TIM10_YARLI70.51%782e-26Mitochondrial import inner membrane translocase subunit TIM10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM10 PE=3 SV=1
A0A1E3PEJ7_9ASCO67.95%783e-26Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83937 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0835

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 97

Detailed signature matches

    1. PF02953 (zf-Tim10_DDP)
    2. SSF144122 (Tim10-like)

Protein sequence

>MCA_05778_1
MSSLFGLGGANNQVANPAKIAAAEAELDMVTDMFNRLVDSCYTKCINLKYDEGSVNKSEGLCLDRCVAKYFQVNTKVGEN
MQKVGAASGGSGFMGRP

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.