Protein

MCA_05771_1

Length
152 amino acids

Description: protein with Homeobox domain-like and transposase IS30-like HTH domains

Browser: contigD:2291462-2291921+

RNA-seq: read pairs 554, FPKM 44.7, percentile rank 62.8% (100% = highest expression)

Protein function

Annotation:protein with Homeobox domain-like and transposase IS30-like HTH domains
EGGNOG:0PTNStransposable element tc3 transposase

Protein alignments

%idAln lengthE-value
UniRef50_A0A084RVZ637.96%1085e-13Uncharacterized protein n=1 Tax=Stachybotrys chartarum IBT 40288 TaxID=1283842 RepID=A0A084RVZ6_STACH

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0537

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 152

Detailed signature matches

  1. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. G3DSA:1.10.10.10
  2. Domain IPR009057
    Homeobox domain-like
    1. SSF46689 (Homeodoma...)
  3. Domain IPR025246
    Transposase IS30-like HTH domain
    1. PF13936 (HTH_38)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05771_1
MDDSKSPLTANRRAGTELTPEARSAIYRMHLEGKSQRQIAKYFNVSQACVSRIKRAYGPTEEFKTKPRPGRPTELSVRDR
RYILRKIAQNPNIQISELRAFGRLTVSDRTIQRFLHTALEELEGQKSDSTNNKVDRLTSRVWAALEARKDPH

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding

Cellular Component

None predicted.