Protein

MCA_05686_1

Length
83 amino acids


Gene name: MRPL33

Description: 54S ribosomal protein L33, mitochondrial

Browser: contigD:2035382-2035634-

RNA-seq: read pairs 1972, FPKM 290.1, percentile rank 91.6% (100% = highest expression)

Protein function

Annotation:MRPL3354S ribosomal protein L33, mitochondrial
EGGNOG:0PST3MRPL33mitochondrial 54S ribosomal protein YmL33
SGD closest match:S000004899MRPL3354S ribosomal protein L33, mitochondrial
CGD closest match:CAL0000179666MRPL33Mitochondrial 54S ribosomal protein YmL33

Protein alignments

%idAln lengthE-value
MIA_04979_171.08%836e-38MIA_04979_1
A0A0J9XCX3_GEOCN69.62%792e-37Similar to Saccharomyces cerevisiae YMR286W MRPL33 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA10s00263g PE=4 SV=1
UniRef50_A0A0J9XCX369.62%794e-34Similar to Saccharomyces cerevisiae YMR286W MRPL33 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCX3_GEOCN
A0A1E4TGK4_9ASCO46.91%813e-21Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26006 PE=4 SV=1
RM33_YEAST46.84%791e-1954S ribosomal protein L33, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL33 PE=1 SV=4
Q6CCK1_YARLI43.21%814e-18YALI0C08723p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C08723g PE=4 SV=1
A0A060TH92_BLAAD45.57%794e-17ARAD1D36960p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36960g PE=4 SV=1
A0A1D8PJ23_CANAL46.25%805e-15Mitochondrial 54S ribosomal protein YmL33 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL33 PE=4 SV=1
A0A1E3PLZ7_9ASCO38.16%761e-09Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82176 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9524
Predicted cleavage: 32

Protein family membership

Domains and repeats

1 10 20 30 40 50 60 70 83

Detailed signature matches

    1. cd01658 (Ribosomal_L30)
    1. SSF55129 (Ribosomal...)
    2. PF00327 (Ribosomal_L30)

Residue annotation

  1. 23S rRNA binding s...

Protein sequence

>MCA_05686_1
MYYRIHLYRSFIGLPQRTRLTCQALGLSKRGKVVYKKVSPQVAGQVLKIKELVKVNLVEDLKTQELELASRKSAPGYNVI
GQA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0015934 large ribosomal subunit