Protein
MCA_05645_1
Length
263 amino acids
Gene name: NSA2
Description: Ribosome biogenesis protein NSA2
Browser: contigD:1908283-1909137+
RNA-seq: read pairs 2264, FPKM 106.0, percentile rank 79.7% (100% = highest expression)
Protein function
Annotation: | NSA2 | Ribosome biogenesis protein NSA2 | |
---|---|---|---|
KEGG: | K14842 | NSA2 | ribosome biogenesis protein NSA2 |
EGGNOG: | 0PJ4S | NSA2 | Ribosome biogenesis protein nsa-2 |
SGD closest match: | S000000928 | NSA2 | Ribosome biogenesis protein NSA2 |
CGD closest match: | CAL0000197650 | NSA2 | Ribosome biogenesis protein NSA2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A167EQZ5_9ASCO | 88.08% | 260 | 5e-173 | Nsa2p OS=Sugiyamaella lignohabitans GN=NSA2 PE=4 SV=1 |
MIA_00020_1 | 87.69% | 260 | 1e-169 | MIA_00020_1 |
A0A0J9XK42_GEOCN | 86.54% | 260 | 4e-169 | Similar to Saccharomyces cerevisiae YER126C NSA2 Protein constituent of 66S pre-ribosomal particles OS=Geotrichum candidum GN=BN980_GECA25s00307g PE=4 SV=1 |
NSA2_YARLI | 86.97% | 261 | 6e-169 | Ribosome biogenesis protein NSA2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NSA2 PE=3 SV=1 |
A0A060TD35_BLAAD | 85.77% | 260 | 3e-167 | ARAD1D39952p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39952g PE=4 SV=1 |
NSA2_CANAL | 85.38% | 260 | 7e-167 | Ribosome biogenesis protein NSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NSA2 PE=3 SV=1 |
A0A1E3PMA8_9ASCO | 84.67% | 261 | 3e-164 | Ribosome biogenesis protein NSA2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46533 PE=4 SV=1 |
NSA2_YEAST | 81.15% | 260 | 2e-159 | Ribosome biogenesis protein NSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSA2 PE=1 SV=1 |
A0A1E4TG26_9ASCO | 74.90% | 259 | 2e-142 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_109245 PE=4 SV=1 |
UniRef50_Q9UU79 | 68.85% | 260 | 2e-127 | Ribosome biogenesis protein nsa2 n=337 Tax=Eukaryota TaxID=2759 RepID=NSA2_SCHPO |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2378
Protein family membership
- Ribosomal protein S8e/ribosomal biogenesis NSA2 (IPR022309)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01201 (Ribosomal_S8e)
-
no IPR
Unintegrated signatures
-
cd11381 (NSA2)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05645_1 MSTPQNEYIEQHIKQHGRRLDYEERQRKKQAREGHRIAKDAQKLTGFRAKMFAQKRYKEKVAMKKKIKQHEESKVDGPSK PNRDQGEALPNYLLDREETNSAKALSTSIKQKRLEKAAKFNVPLPKVRGISEEEMFKVLKSGKRQNKSWKRMITKHTFVG EGFTRRPVKLERIIRPTALRQKKANVTHPELGVTVNLPILGVKKNPQSPMYTQLGVLTRGTIIEVNVSELGIVTAGGKVV WGKYAQITNEPDRDGCVNAVLLV
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.