Protein
MCA_05632_1
Length
288 amino acids
Gene name: MRPL13
Description: Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit
Browser: contigD:1857178-1858045-
RNA-seq: read pairs 2089, FPKM 89.3, percentile rank 77.0% (100% = highest expression)
Protein function
Annotation: | MRPL13 | Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01768_1 | 33.88% | 183 | 3e-23 | MIA_01768_1 |
A0A0J9X7C8_GEOCN | 32.96% | 179 | 2e-22 | Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA03s05983g PE=4 SV=1 |
UniRef50_A0A0J9X7C8 | 32.96% | 179 | 4e-19 | Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7C8_GEOCN |
A0A167C8M7_9ASCO | 34.59% | 185 | 2e-21 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_4166 PE=4 SV=1 |
A0A060T3D3_BLAAD | 33.93% | 168 | 3e-17 | ARAD1A08822p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08822g PE=4 SV=1 |
A0A1E3PP68_9ASCO | 32.07% | 184 | 8e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50558 PE=4 SV=1 |
Q6C881_YARLI | 33.67% | 98 | 1e-09 | YALI0D21934p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D21934g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9980
Predicted cleavage: 55
Protein family membership
- Ribosomal protein L50, mitochondria (IPR018305)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10501 (Ribosomal_L50)
-

Unintegrated signatures
Protein sequence
>MCA_05632_1 MSIYTRATLLKRVTASAVQSSSTTVISLRSGFHTRSVEYNLLASLANRFKMLRPSTRAKKPVAVEDEAAVKRLQTKDIKS VESQLKNREEQQALVEEAQAARELEVLGMPAYDTVESWEAESNGFKIVPFPINLQNEKLDDLDLVKGAIFRAATAHGLFP ANATAPPEGEQWLSDIVFDDIKTRFLVFKQIQKELDIQIPDPELSRIGSAEMLFEYFLDKVHGVKRFNPKEPNAIHLDPQ EFIGTNITLKNGGLSDAEVRKLKKQRWRELVKEAKSKQEEVLKSALNN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion