Protein

MCA_05632_1

Length
288 amino acids


Gene name: MRPL13

Description: Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit

Browser: contigD:1857178-1858045-

RNA-seq: read pairs 2089, FPKM 89.3, percentile rank 77.0% (100% = highest expression)

Protein function

Annotation:MRPL13Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit

Protein alignments

%idAln lengthE-value
MIA_01768_133.88%1833e-23MIA_01768_1
A0A0J9X7C8_GEOCN32.96%1792e-22Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA03s05983g PE=4 SV=1
UniRef50_A0A0J9X7C832.96%1794e-19Similar to Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7C8_GEOCN
A0A167C8M7_9ASCO34.59%1852e-21Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_4166 PE=4 SV=1
A0A060T3D3_BLAAD33.93%1683e-17ARAD1A08822p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08822g PE=4 SV=1
A0A1E3PP68_9ASCO32.07%1848e-14Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50558 PE=4 SV=1
Q6C881_YARLI33.67%981e-09YALI0D21934p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D21934g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9980
Predicted cleavage: 55

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF10501 (Ribosomal_L50)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05632_1
MSIYTRATLLKRVTASAVQSSSTTVISLRSGFHTRSVEYNLLASLANRFKMLRPSTRAKKPVAVEDEAAVKRLQTKDIKS
VESQLKNREEQQALVEEAQAARELEVLGMPAYDTVESWEAESNGFKIVPFPINLQNEKLDDLDLVKGAIFRAATAHGLFP
ANATAPPEGEQWLSDIVFDDIKTRFLVFKQIQKELDIQIPDPELSRIGSAEMLFEYFLDKVHGVKRFNPKEPNAIHLDPQ
EFIGTNITLKNGGLSDAEVRKLKKQRWRELVKEAKSKQEEVLKSALNN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0005739 mitochondrion