Protein

MCA_05623_1

Length
303 amino acids


Gene name: RPF1

Description: Ribosome production factor 1

Browser: contigD:1822144-1823056+

RNA-seq: read pairs 755, FPKM 30.7, percentile rank 53.3% (100% = highest expression)

Protein function

Annotation:RPF1Ribosome production factor 1
KEGG:K14846RPF1 ribosome production factor 1
EGGNOG:0PI8VFG05466.1factor 1
SGD closest match:S000001130RPF1Ribosome production factor 1
CGD closest match:CAL0000187860RPF1rRNA-binding ribosome biosynthesis protein

Protein alignments

%idAln lengthE-value
MIA_04903_176.90%3037e-178MIA_04903_1
A0A0J9X869_GEOCN67.33%3031e-152Similar to Saccharomyces cerevisiae YHR088W RPF1 Nucleolar protein involved in the assembly and export of the large ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA05s04377g PE=4 SV=1
A0A1E3PJ61_9ASCO64.33%3001e-144Putative nucleolar ribosomal biogenesis factor RPF1p OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83272 PE=4 SV=1
A0A167CXA4_9ASCO63.49%3046e-142Rpf1p OS=Sugiyamaella lignohabitans GN=RPF1 PE=4 SV=1
A0A060T8G3_BLAAD62.38%3034e-138ARAD1D03344p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03344g PE=4 SV=1
Q6C0V2_YARLI64.85%2938e-138YALI0F21483p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F21483g PE=4 SV=1
UniRef50_Q757V561.43%2937e-132AEL093Cp n=31 Tax=Fungi TaxID=4751 RepID=Q757V5_ASHGO
RPF1_YEAST58.53%2991e-128Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1
Q5AFD8_CANAL56.44%3036e-129rRNA-binding ribosome biosynthesis protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPF1 PE=4 SV=1
A0A1E4TCN8_9ASCO56.23%2976e-117Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4104 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7104

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 303

Detailed signature matches

    1. SSF52954 (Class II ...)
    1. SM00879 (Brix_2)
    2. PS50833 (BRIX)
    3. PF04427 (Brix)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05623_1
MGRGTADGKVFRIKNKIRREEVVGRYRDVVNKEKHKMRIERARQETKDPALKQARLAKNIPATLDNKRVYDETIGAEVEG
EDEFADYFKPAEDEDGKPKPPKVLITTNVGAKKYADKFAEMLQEIIPDSTYIQRKPQFTIKHMTTFCSNRNYTDLIILNE
DKKTVNGITFIHLPEGPTFYFSVSSIKYPEKIPGAGKPTSHVPELILNKFSTRLGLTVGRMFQSLFPQQPDFKGRQVVTL
HNQRDFIFFRRHRYMFKNEDRVGLQELGPQFTLRLRRLQKGIREEVEWEHRPEMDKDKKKFYL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.