Protein

MCA_05615_1

Length
399 amino acids


Browser: contigD:1804671-1805946-

RNA-seq: read pairs 1192, FPKM 36.8, percentile rank 58.5% (100% = highest expression)

Protein function

EGGNOG:0PJGQFG06345.1Ribosome biogenesis protein
SGD closest match:S000001565RRP14Ribosomal RNA-processing protein 14
CGD closest match:CAL0000200640orf19.2167Ribosome biosynthesis protein

Protein alignments

%idAln lengthE-value
MIA_00860_162.86%2451e-68MIA_00860_1
A0A0J9X919_GEOCN46.81%2354e-32Similar to Saccharomyces cerevisiae YKL082C RRP14 Essential protein, constituent of 66S pre-ribosomal particles OS=Geotrichum candidum GN=BN980_GECA05s04850g PE=4 SV=1
UniRef50_A0A0J9X91946.81%2359e-29Similar to Saccharomyces cerevisiae YKL082C RRP14 Essential protein, constituent of 66S pre-ribosomal particles n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X919_GEOCN
A0A161HGD0_9ASCO47.76%2452e-30Rrp14p OS=Sugiyamaella lignohabitans GN=RRP14 PE=4 SV=1
A0A1E4THH1_9ASCO40.43%2304e-28Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2899 PE=4 SV=1
A0A1E3PI65_9ASCO43.97%2324e-27SURF6-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_66233 PE=4 SV=1
A0A060TEI7_BLAAD46.46%2261e-19ARAD1D07920p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D07920g PE=4 SV=1
A0A1D8PI86_CANAL37.89%2564e-15Ribosome biosynthesis protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2167 PE=4 SV=1
Q6C2V9_YARLI34.03%2382e-10YALI0F04708p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04708g PE=4 SV=1
RRP14_YEAST33.07%2573e-10Ribosomal RNA-processing protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP14 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5609

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 300 350 399

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05615_1
MSKALEERLRSHSDAFQGLLSLIPEDPKPITKRAKKRAKKAKLLSKTGKNEDPVEEVTEPVASAPAEEDEKTIIYDDEGN
FVESIGADNDVDMDDGDDKNTQEKSASNTVEPKSNNNKSESKSDKDDKLAEKEASQSTNDTPQPSKQKPDPEKIKELREK
LASKIQQFKEKRKAPGTVTNGTVRTREAILAARREKEKREKEKAARRKERAQKEDANDENDDDYEQTKVDDSNLLFSQVT
FADGSKATADLKELRHERSKKGPRDILGQLKHVQAQKSKIASKKDSEARATLESKSTWSKAIAQAEGIKIQDDEKKLKAS
LKKHKKQKQKSEKEWQERKETVAKDQLAKQQRRQDHIALKIERSKLHGKKAKKRAGFEGGIAKTRLKKLKAASSRVHKK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.