Protein
MCA_05596_1
Length
233 amino acids
Gene name: VMA4
Description: V-type proton ATPase subunit E
Browser: contigD:1763055-1763932+
RNA-seq: read pairs 11356, FPKM 599.6, percentile rank 95.0% (100% = highest expression)
Protein function
| Annotation: | VMA4 | V-type proton ATPase subunit E | |
|---|---|---|---|
| KEGG: | K02150 | ATPeV1E | V-type H+-transporting ATPase subunit E |
| EGGNOG: | 0PJA9 | VMA4 | Vacuolar ATP synthase subunit e |
| SGD closest match: | S000005859 | VMA4 | V-type proton ATPase subunit E |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01897_1 | 71.67% | 233 | 3e-90 | MIA_01897_1 |
| A0A0J9XAK2_GEOCN | 64.38% | 233 | 7e-73 | Similar to Saccharomyces cerevisiae YOR332W VMA4 Subunit E of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) OS=Geotrichum candidum GN=BN980_GECA07s00835g PE=3 SV=1 |
| A0A060T3R2_BLAAD | 61.80% | 233 | 1e-71 | ARAD1A11594p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A11594g PE=3 SV=1 |
| A0A1E3PGM7_9ASCO | 59.83% | 229 | 6e-70 | Vacuolar ATP synthase subunit E OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83526 PE=3 SV=1 |
| A0A167EDX8_9ASCO | 57.51% | 233 | 4e-68 | H(+)-transporting V1 sector ATPase subunit E OS=Sugiyamaella lignohabitans GN=VMA4 PE=3 SV=1 |
| A0A1D8PS38_CANAL | 54.87% | 226 | 2e-65 | H(+)-transporting V1 sector ATPase subunit E OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA4 PE=3 SV=1 |
| UniRef50_K0KQH4 | 52.33% | 193 | 3e-57 | V-type proton ATPase subunit E n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) TaxID=1206466 RepID=K0KQH4_WICCF |
| Q6C1K0_YARLI | 55.02% | 229 | 1e-57 | YALI0F15631p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15631g PE=3 SV=2 |
| VATE_YEAST | 51.10% | 227 | 2e-52 | V-type proton ATPase subunit E OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA4 PE=1 SV=4 |
| A0A1E4TJK7_9ASCO | 45.08% | 193 | 4e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30219 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3154
Protein family membership
- ATPase, V1/A1 complex, subunit E (IPR002842)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Protein sequence
>MCA_05596_1 MPATVAKSLSDDQVAGELRKMVEFIKKEADEKAKEIELKANEEYEIEKASVVRSETAAIDALYERKYKQSKLSQQIAKST VANKARLKVLEAREDVVTSIFEEASAQLANLTKDTDKYKKVMEGLIEEAALQLLEPSIKVKCKKGDASVVKSVLDDVVKY YKDATKGKELEAVVDEESFLGDNIAGGVIVSNKSGKIEVNNTFDERLKLLQEQSLPAIRLAVFGPSESRKFFN
GO term prediction
Biological Process
GO:0015991 ATP hydrolysis coupled proton transport
Molecular Function
GO:0046961 proton-transporting ATPase activity, rotational mechanism
Cellular Component
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain