Protein

MCA_05571_1

Length
339 amino acids


Gene name: SIN3A

Description: Transcriptional regulatory protein SIN3

Browser: contigD:1673677-1674697+

RNA-seq: read pairs 590, FPKM 21.4, percentile rank 43.2% (100% = highest expression)

Protein function

Annotation:SIN3ATranscriptional regulatory protein SIN3
EGGNOG:0PFTTSIN3Paired amphipathic helix protein
SGD closest match:S000005364SIN3Transcriptional regulatory protein SIN3
CGD closest match:CAL0000177059SIN3Transcriptional regulator

Protein alignments

%idAln lengthE-value
UniRef50_A0A075B4F427.27%3191e-09Paired amphipathic helix domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B4F4_9FUNG
MIA_00891_133.75%807e-10MIA_00891_1
A0A1E3PS83_9ASCO47.46%593e-08Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_30554 PE=4 SV=1
A0A1E4TDT6_9ASCO45.76%594e-08Serine/threonine-protein kinase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1662 PE=3 SV=1
F2Z640_YARLI39.47%768e-08YALI0D26315p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D26315g PE=4 SV=1
SIN3_YEAST40.62%641e-07Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2
A0A1D8PCC3_CANAL45.76%592e-07Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIN3 PE=4 SV=1
A0A060TBF2_BLAAD45.76%594e-07ARAD1B07018p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07018g PE=4 SV=1
A0A0J9XCE6_GEOCN45.76%594e-07Similar to Saccharomyces cerevisiae YOL004W SIN3 Component of the Sin3p-Rpd3p histone deacetylase complex OS=Geotrichum candidum GN=BN980_GECA09s02463g PE=4 SV=1
A0A167C5G6_9ASCO45.76%593e-07Transcriptional regulator SIN3 OS=Sugiyamaella lignohabitans GN=SIN3 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0409

Protein family membership

None predicted.

Domains and repeats

  1. Repeat
1 50 100 150 200 250 300 339

Detailed signature matches

    1. PS51477 (PAH)
    2. PF02671 (PAH)
    3. SSF47762 (PAH2 domain)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05571_1
MEVSFECYPQLILHNTPYFFDQINQDLSKFPIIYSRFLELTQLYKLSKISTAEYIIRSHFLFIGFCDSLIFAFNHVLPPG
YYLICDNGDLHPRLLTTNIIFGSVNAQDSVAEKPTKMSAPSVSSLVLSNTQLTVSQCPISPPASPSIQSTGLTKTLRCES
FDIRKGNSSSSHKELNSTDFVGLDCFPVRNTNNKLIKKSSTRTILKKEPHPASQNPVKPLPEINIKSQPVKILPKPKHEK
NKSGSYHHYRNPSTSVFRYVERIKNRFQNTPEIFTQFLIILRSYNSGKTPPLEVYNSVANLFLPGSKDLLAEFRSFLPPS
ISYPPISKPDDVKVSSNQS

GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-templated

Molecular Function

None predicted.

Cellular Component

None predicted.