Protein

MCA_05538_1

Length
189 amino acids


Gene name: DOC1

Description: Anaphase-promoting complex subunit DOC1

Browser: contigD:1583063-1583854-

RNA-seq: read pairs 314, FPKM 20.4, percentile rank 42.0% (100% = highest expression)

Protein function

Annotation:DOC1Anaphase-promoting complex subunit DOC1
KEGG:K03357APC10 anaphase-promoting complex subunit 10
EGGNOG:0PPMADOC1complex subunit 10
SGD closest match:S000003209DOC1Anaphase-promoting complex subunit DOC1
CGD closest match:CAL0000181158orf19.5056Anaphase promoting complex subunit

Protein alignments

%idAln lengthE-value
MIA_00902_176.74%1725e-100MIA_00902_1
A0A0J9X2H1_GEOCN62.43%1811e-80Anaphase-promoting complex subunit 10 OS=Geotrichum candidum GN=BN980_GECA01s01528g PE=3 SV=1
A0A1E3PMR0_9ASCO57.75%1876e-75Anaphase-promoting complex subunit 10 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_65259 PE=3 SV=1
UniRef50_A0A1E3PMR057.75%1872e-71Anaphase-promoting complex subunit 10 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PMR0_9ASCO
A0A060TDP3_BLAAD52.13%1881e-69Anaphase-promoting complex subunit 10 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08888g PE=3 SV=1
Q6C6Q9_YARLI55.42%1667e-67Anaphase-promoting complex subunit 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E07117g PE=3 SV=1
A0A167FY07_9ASCO47.10%1552e-49Anaphase promoting complex subunit DOC1 OS=Sugiyamaella lignohabitans GN=DOC1 PE=4 SV=1
A0A1D8PE86_CANAL41.44%1811e-43Anaphase promoting complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5056 PE=4 SV=1
APC10_YEAST36.31%1681e-33Anaphase-promoting complex subunit DOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOC1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0245

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 189

Detailed signature matches

    1. cd08366 (APC10)
    1. SSF49785 (Galactose...)
    1. PS51284 (DOC)
    2. SM01337 (APC10_2)
    3. PF03256 (ANAPC10)

Residue annotation

  1. putative ligand bi...

Protein sequence

>MCA_05538_1
MSQNDDIEMAYKAGITEMESKGYTDIGNLAMWSVSSYKLGFGVDSLRVDDPTKLWQSDGPQPHYVDIHFSKKVSVGQISL
FFNHLVDESYTPSKIRILAGDGYHSLLQVTTIDLAEPTGWSNVSFDTVRSDGILKTFLIRIEVLSNHQNGKDTHIRSIKV
YSPSKQSIAFEDQEISFKTIPLLSESCIR

GO term prediction

Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process

Molecular Function

None predicted.

Cellular Component

GO:0005680 anaphase-promoting complex