Protein
MCA_05505_1
Length
206 amino acids
Gene name: SYM1
Description: Protein SYM1; mitochondrial protein involved in ethanol metabolism
Browser: contigD:1491937-1492618+
RNA-seq: read pairs 244, FPKM 14.6, percentile rank 33.3% (100% = highest expression)
Protein function
Annotation: | SYM1 | Protein SYM1; mitochondrial protein involved in ethanol metabolism | |
---|---|---|---|
KEGG: | K13348 | MPV17 | protein Mpv17 |
EGGNOG: | 0PNK9 | SYM1 | May be involved in cellular response to stress. Required to maintain mitochondrial DNA (mtDNA) integrity and stability (By similarity) |
SGD closest match: | S000004241 | SYM1 | Protein SYM1 |
CGD closest match: | CAL0000199251 | SYM1 | Protein SYM1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02657_1 | 44.44% | 216 | 1e-61 | MIA_02657_1 |
UniRef50_Q6BMY0 | 39.39% | 198 | 8e-42 | Protein SYM1 n=12 Tax=Debaryomycetaceae TaxID=766764 RepID=SYM1_DEBHA |
A0A1E3PPQ4_9ASCO | 40.10% | 197 | 3e-44 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81889 PE=3 SV=1 |
A0A0J9XJU4_GEOCN | 39.11% | 202 | 7e-42 | Similar to Saccharomyces cerevisiae YLR251W SYM1 Protein required for ethanol metabolism OS=Geotrichum candidum GN=BN980_GECA25s00252g PE=3 SV=1 |
SYM1_YEAST | 41.45% | 193 | 3e-41 | Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYM1 PE=1 SV=1 |
A0A060SXX2_BLAAD | 39.38% | 193 | 2e-41 | ARAD1A07986p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07986g PE=3 SV=1 |
SYM1_CANAL | 39.89% | 183 | 3e-40 | Protein SYM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SYM1 PE=3 SV=1 |
A0A167FXW3_9ASCO | 36.06% | 208 | 1e-32 | Sym1p OS=Sugiyamaella lignohabitans GN=SYM1 PE=3 SV=1 |
A0A1E4TF97_9ASCO | 35.88% | 170 | 2e-24 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13977 PE=3 SV=1 |
SYM1_YARLI | 29.41% | 187 | 1e-21 | Protein SYM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYM1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9165
Protein family membership
- Mpv17/PMP22 (IPR007248)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04117 (Mpv17_PMP22)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_05505_1 MSFFKFTSAYNKAITSRPVLVNMLTTGFLFGTGDLLAQAITNYSSEEKKRMDLTRTARAVTYGGLIFGPIGSKYYQLLQK VRIPMANPQNKKSIEFMSEVFPRVFVDQLGFSPCACAFYYVAMSYMEGITNWNEIVETKLEPNWWPTYKTNLLIWPAIQF ANFSFIPVPYRLLTVNVAGVGWNAFISYRNAHKVHKVVHNTEQEGK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane