Protein

MCA_05490_1

Length
135 amino acids


Browser: contigD:1450559-1451042-

RNA-seq: read pairs 298, FPKM 27.1, percentile rank 49.8% (100% = highest expression)

Protein function

KEGG:K20303TRAPPC4 trafficking protein particle complex subunit 4
EGGNOG:0PRFIprotein particle complex subunit
SGD closest match:S000002654TRS23Trafficking protein particle complex subunit 23
CGD closest match:CAL0000180328orf19.3673TRAPP subunit

Protein alignments

%idAln lengthE-value
A0A0J9X6M0_GEOCN70.15%1348e-72Similar to Saccharomyces cerevisiae YDR246W TRS23 One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion OS=Geotrichum candidum GN=BN980_GECA03s01847g PE=4 SV=1
MIA_00594_167.61%1426e-70MIA_00594_1
A0A060TB22_BLAAD64.18%1342e-64ARAD1B12122p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12122g PE=4 SV=1
Q6CDP3_YARLI63.43%1342e-63YALI0B22396p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B22396g PE=4 SV=1
UniRef50_Q6CDP363.43%1344e-60YALI0B22396p n=10 Tax=Eukaryota TaxID=2759 RepID=Q6CDP3_YARLI
A0A1E3PQ89_9ASCO60.45%1342e-62Sybindin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45661 PE=4 SV=1
A0A1E4TF42_9ASCO59.40%1335e-59Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2118 PE=4 SV=1
Q59VY5_CANAL37.97%1582e-32TRAPP subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3673 PE=4 SV=1
TRS23_YEAST46.15%524e-14Trafficking protein particle complex subunit 23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS23 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1774
Predicted cleavage: 13

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 135

Detailed signature matches

    1. PF04099 (Sybindin)
    2. SM01399 (Sybindin_2)
    1. SSF64356 (SNARE-like)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05490_1
MAVQSLYILNRAGGLVYQKDFKQNLNKLSTNEYLVLAGTFHSIHAIASRVSPLTKSSGITQVELGKYTMHCFQTLTGVKF
LLITDLKQMNTDSIMNRVYQLYADYVLKNPFYQLDMPIRCDNFDLELNKFLSSIF

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

None predicted.

Cellular Component

GO:0030008 TRAPP complex