Protein
MCA_05447_1
Length
326 amino acids
Browser: contigD:1346796-1347777-
RNA-seq: read pairs 53, FPKM 2.0, percentile rank 11.7% (100% = highest expression)
Protein function
| EGGNOG: | 0PJXJ | FG08570.1 | RTA1 domain protein |
|---|---|---|---|
| SGD closest match: | S000005575 | RSB1 | Sphingoid long-chain base transporter RSB1 |
| CGD closest match: | CAL0000175352 | RTA2 | Phospholipid-translocating ATPase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02203_1 | 44.19% | 301 | 4e-91 | MIA_02203_1 |
| A0A0J9XE14_GEOCN | 41.19% | 318 | 1e-83 | Similar to Saccharomyces cerevisiae YOR049C RSB1 Suppressor of sphingoid long chain base (LCB) sensitivity of an LCB-lyase mutation OS=Geotrichum candidum GN=BN980_GECA11s02683g PE=4 SV=1 |
| UniRef50_W6ML59 | 41.08% | 297 | 3e-68 | Uncharacterized protein n=1 Tax=Kuraishia capsulata CBS 1993 TaxID=1382522 RepID=W6ML59_9ASCO |
| A0A1E3PK67_9ASCO | 35.37% | 311 | 2e-59 | RTA1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46449 PE=4 SV=1 |
| Q6C4D0_YARLI | 34.88% | 324 | 2e-58 | YALI0E27786p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E27786g PE=4 SV=1 |
| A0A060TAK6_BLAAD | 35.71% | 322 | 1e-53 | ARAD1D27698p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27698g PE=4 SV=1 |
| Q59Q40_CANAL | 32.84% | 335 | 1e-50 | Phospholipid-translocating ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RTA2 PE=4 SV=1 |
| RSB1_YEAST | 34.25% | 292 | 4e-48 | Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 |
| A0A1E4TEQ3_9ASCO | 33.33% | 288 | 2e-45 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24188 PE=4 SV=1 |
| A0A167CS14_9ASCO | 50.40% | 125 | 2e-37 | Phospholipid-translocating ATPase RSB1 OS=Sugiyamaella lignohabitans GN=RSB1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0407
Protein family membership
- RTA-like protein (IPR007568)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04479 (RTA1)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_05447_1 MSSGRAGGGYYNPHHYIPNYAGNLASAVLYGVLLIWGIASGIYYKQWWFGTMFFCGSVLEVLGYIGRTLASNEADVDNMD YFIWQIICLTMAPSFYMAGIYYLLANFSVIYGNGISRLKPMWYSYIFITCDLISICIQGAGGAISAVSTTNPDAVKTGTN VLIAGLVIQLIAIAVFGGFCLDFYLMVQKRKKQAFEQNPELYRLTREEIDSTIFEPRYAFVRNKRPLFKVFILSVLACTT LIFIRSVFRTIEFAVPEDSVLRTKEVYMFVFDTIPVFIGVALMVYVHPGRVFGKDVKIDVKSKSFKLPKNYDDLSYSTSN VELLRR
GO term prediction
Biological Process
GO:0006950 response to stress
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane