Protein
MCA_05435_1
Length
624 amino acids
Gene name: SRP68
Description: Signal recognition particle subunit SRP68
Browser: contigD:1322519-1324394-
RNA-seq: read pairs 3282, FPKM 64.9, percentile rank 70.9% (100% = highest expression)
Protein function
Annotation: | SRP68 | Signal recognition particle subunit SRP68 | |
---|---|---|---|
KEGG: | K03107 | SRP68 | signal recognition particle subunit SRP68 |
EGGNOG: | 0PFE9 | FG06156.1 | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane (By similarity) |
SGD closest match: | S000006164 | SRP68 | Signal recognition particle subunit SRP68 |
CGD closest match: | CAL0000186213 | orf19.6804 | Signal recognition particle subunit SRP68 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00420_1 | 50.93% | 593 | 0.0 | MIA_00420_1 |
A0A0J9XH36_GEOCN | 36.67% | 630 | 1e-103 | Signal recognition particle subunit SRP68 OS=Geotrichum candidum GN=BN980_GECA16s00450g PE=3 SV=1 |
UniRef50_A0A0J9XH36 | 36.67% | 630 | 3e-100 | Signal recognition particle subunit SRP68 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XH36_GEOCN |
A0A060T2R0_BLAAD | 33.54% | 635 | 6e-89 | Signal recognition particle subunit SRP68 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27236g PE=3 SV=1 |
A0A167DII6_9ASCO | 30.69% | 593 | 3e-68 | Signal recognition particle subunit SRP68 OS=Sugiyamaella lignohabitans GN=SRP68 PE=3 SV=1 |
A0A1E3PDV3_9ASCO | 27.88% | 599 | 1e-60 | Signal recognition particle subunit SRP68 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84234 PE=3 SV=1 |
Q6CBG8_YARLI | 29.76% | 588 | 1e-53 | Signal recognition particle subunit SRP68 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18997g PE=3 SV=1 |
Q5ADN7_CANAL | 21.53% | 627 | 2e-20 | Signal recognition particle subunit SRP68 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6804 PE=3 SV=1 |
SRP68_YEAST | 25.00% | 616 | 3e-16 | Signal recognition particle subunit SRP68 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP68 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0502
Protein family membership
- Signal recognition particle subunit SRP68 (IPR026258)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF038995 (SRP68)
-
PF16969 (SRP68)
-

Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05435_1 MPSLQPINEILNDRSELPLQSATDYRQYRVRATRKLARTRKSLGLQKKPPKKNQSAEPRHRLPFEAPSIDQLEKDKSAIS VLVYLAERSWAHAMETSAVLDTNFSTNKKSHVRSKLFKACKYIDIATKLVEESPKLFDENEIFQLETYALLLHGNLSFQT KRYERCINQYSIVRVALDTISSLPDTDASTRSSIQELILTVIDPSIVYSYYRINKVRPLSASSLAIKTASQSDSKVSKIV KKINPAAITPSEESDSSILDKIQWRSYTADVEDKELGLLLSKTITADKEIDSTKISLQSAKIESSLSIFDDVLQSWQDSR DLVKNNIERLESSSSASQTIQTQYIISTFIEYNMLLRRIQRDVLLLKNVESRFNKLTNSTKTKVNNTKLFEKMQEVVRLY DTIIQSTSELLDLPGIHTDSELQSALQTLDSYYKSERLNALANAYKIASKLPEALALYASSLQTLQTSPMSVSIEFPPNV LDKSKFENAVISTKISVLQLRSVLTIRDNGEKHGNLSDRMDVDGVEPINVGSKAVVDNLSKYSLNALGSANEVAENLISI NTEILPVIAKPVFFDIAYNFIGKNTDNASVSSTSATTSSESSNNNNNNNKKKSGGFLSGLWGSK
GO term prediction
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Molecular Function
GO:0005047 signal recognition particle binding
GO:0008312 7S RNA binding
GO:0030942 endoplasmic reticulum signal peptide binding
Cellular Component
GO:0005786 signal recognition particle, endoplasmic reticulum targeting