Protein

MCA_05413_1

Length
145 amino acids


Browser: contigD:1265826-1266373+

RNA-seq: read pairs 53697, FPKM 4544.4, percentile rank 99.5% (100% = highest expression)

Protein function

KEGG:K02973RP-S23e small subunit ribosomal protein S23e
EGGNOG:0PMW1RPS2340s ribosomal protein s23
SGD closest match:S000003350RPS23A40S ribosomal protein S23-A
CGD closest match:CAL0000197722RPS23ARibosomal 40S subunit protein S23B

Protein alignments

%idAln lengthE-value
A0A161HM14_9ASCO94.48%1452e-97Ribosomal 40S subunit protein S23B OS=Sugiyamaella lignohabitans GN=RPS23B PE=3 SV=1
A0A060SWY1_BLAAD93.79%1454e-97ARAD1A09108p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09108g PE=3 SV=1
MIA_03605_195.17%1452e-96MIA_03605_1
A0A0F7RRT7_GEOCN93.10%1459e-96Similar to Saccharomyces cerevisiae YGR118W RPS23A Ribosomal protein 28 (Rp28) of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA05s05840g PE=3 SV=1
A0A1D8PDU3_CANAL92.41%1457e-96Ribosomal 40S subunit protein S23B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS23A PE=3 SV=1
Q6CGB1_YARLI92.41%1456e-95YALI0A20746p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A20746g PE=3 SV=1
RS23A_YEAST91.72%1451e-9440S ribosomal protein S23-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS23A PE=1 SV=1
A0A1E4TFQ2_9ASCO92.41%1456e-94Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107064 PE=3 SV=1
UniRef50_Q9UVJ789.66%1452e-90Ribosomal protein S28 n=41 Tax=Opisthokonta TaxID=33154 RepID=Q9UVJ7_ASPNG
A0A1E3PR61_9ASCO38.96%776e-0830S ribosomal protein S12 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_6727 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1595

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 145

Detailed signature matches

    1. PS00055 (RIBOSOMAL_S12)
    2. PF00164 (Ribosom_S1...)
    3. PIRSF002133 (RPS12p...)
    1. cd03367 (Ribosomal_S23)
    1. SSF50249 (Nucleic a...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. 18S rRNA interacti...
  2. streptomycin inter...
  3. 28S rRNA interacti...
  4. aminoacyl-tRNA int...
  5. eEF2 interaction s...

Protein sequence

>MCA_05413_1
MGKGKPRGLNAARKLRINRRENRWADMAYKKRLLGTAFKSSPFGGSSHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNG
KKVTAFVPNDGCLNFVDENDEVLIAGFGRKGKAKGDIPGVRFKVVKVSGVSLIALWKEKKEKPRS

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015935 small ribosomal subunit