Protein

MCA_05404_1

Length
121 amino acids


Gene name: SWS2

Description: 37S ribosomal protein SWS2, mitochondrial

Browser: contigD:1240121-1240580+

RNA-seq: read pairs 4501, FPKM 455.9, percentile rank 93.9% (100% = highest expression)

Protein function

Annotation:SWS237S ribosomal protein SWS2, mitochondrial
KEGG:K02952RP-S13 small subunit ribosomal protein S13
EGGNOG:0PP77PGUG_01930Mitochondrial 37S ribosomal protein SWS2
SGD closest match:S000005025SWS237S ribosomal protein SWS2, mitochondrial
CGD closest match:CAL0000183829CAALFM_CR08400CAPutative mitochondrial 37S ribosomal protein SWS2

Protein alignments

%idAln lengthE-value
MIA_00282_179.17%1202e-66MIA_00282_1
A0A0J9X8Z2_GEOCN75.83%1207e-63Similar to Saccharomyces cerevisiae YNL081C SWS2 Putative mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA04s07028g PE=3 SV=1
A0A060T917_BLAAD68.60%1215e-55ARAD1D11968p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11968g PE=3 SV=1
SWS2_YEAST58.33%1203e-5037S ribosomal protein SWS2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWS2 PE=1 SV=1
UniRef50_P5393758.33%1207e-4737S ribosomal protein SWS2, mitochondrial n=68 Tax=Saccharomycetales TaxID=4892 RepID=SWS2_YEAST
A0A1E3PJE3_9ASCO62.18%1194e-50Putative mitochondrial ribosomal protein of the small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51918 PE=3 SV=1
A0A1E4TIS9_9ASCO60.00%1202e-48Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_74003 PE=3 SV=1
Q6CFI9_YARLI42.98%1211e-31YALI0B06578p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B06578g PE=3 SV=1
Q5A357_CANAL42.02%1193e-30Putative mitochondrial 37S ribosomal protein SWS2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR08400CA PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8650
Predicted cleavage: 16

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 121

Detailed signature matches

    1. PF00416 (Ribosomal_S13)
    2. PS50159 (RIBOSOMAL_...)
    3. MF_01315 (Ribosomal...)
    4. PIRSF002134 (RPS13p...)
    1. SSF46946 (S13-like ...)
    1. PS00646 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05404_1
MTTNIMGKSFRGNRLVSIGLAAKFYALGINNATKICSKLGFYPQKRMHQLTEQDVLAINAELANYTIEKEALNIVRSNIA
LKRNIGSYAGRRHAMNLPVRGQGTRNNARTAKKLNRLDRKF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome