Protein
MCA_05399_1
Length
121 amino acids
Gene name: HRT1
Description: RING-H2 domain core subunit of multiple ubiquitin ligase complexes; protein with Zn-finger Zinc finger, RING/FYVE/PHD-type domain
Browser: contigD:1230647-1231162-
RNA-seq: read pairs 2523, FPKM 255.5, percentile rank 90.6% (100% = highest expression)
Protein function
Annotation: | HRT1 | RING-H2 domain core subunit of multiple ubiquitin ligase complexes; protein with Zn-finger Zinc finger, RING/FYVE/PHD-type domain | |
---|---|---|---|
KEGG: | K03868 | RBX1 | RING-box protein 1 |
EGGNOG: | 0PNSJ | FG02497.1 | ring-box protein |
SGD closest match: | S000005493 | HRT1 | RING-box protein HRT1 |
CGD closest match: | CAL0000179194 | HRT1 | SCF ubiquitin ligase complex subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02518_1 | 88.46% | 104 | 2e-64 | MIA_02518_1 |
UniRef50_A0A0J5PRQ9 | 66.67% | 117 | 6e-52 | Ubiquitin ligase subunit HrtA n=3 Tax=Neosartorya fumigata TaxID=746128 RepID=A0A0J5PRQ9_ASPFM |
A0A1E3PF72_9ASCO | 66.67% | 120 | 4e-55 | Putative ubiquitin ligase subunit HrtA OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53043 PE=4 SV=1 |
A0A0J9YHI5_GEOCN | 76.53% | 98 | 2e-54 | Similar to Saccharomyces cerevisiae YOL133W HRT1 RING finger containing subunit of Skp1-Cullin-F-box ubiquitin protein ligases (SCF) OS=Geotrichum candidum GN=BN980_GECA01s04938g PE=4 SV=1 |
A0A060TD61_BLAAD | 75.86% | 87 | 7e-49 | ARAD1D40282p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40282g PE=4 SV=1 |
Q6CE99_YARLI | 59.83% | 117 | 2e-47 | YALI0B17358p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B17358g PE=4 SV=2 |
A0A1E4TIV5_9ASCO | 70.45% | 88 | 3e-46 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_55445 PE=4 SV=1 |
RBX1_YEAST | 51.67% | 120 | 3e-44 | RING-box protein HRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRT1 PE=1 SV=1 |
A0A1D8PJL5_CANAL | 62.11% | 95 | 5e-41 | SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HRT1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0159
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
121
Detailed signature matches

Unintegrated signatures
-
SSF57850 (RING/U-box)
-
cd16485 (mRING-H2-C...)
-
mobidb-lite (disord...)
Residue annotation
-
Zn binding site cd...
-
polypeptide substr...
Protein sequence
>MCA_05399_1 MSEEPKDVEMTTETTASNEKPATSDKKSKPTKKRFEVRKWSAVAFWSWDIVVDTCAICRNHIMEPCIDCQANQNSSTAED CTIAWGTCNHAFHFHCISRWIKQRQVCPLDNREWELQKIGA
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0008270 zinc ion binding
Cellular Component
None predicted.