MCA_05378_1
Gene name: GDI1
Description: Rab GDP-dissociation inhibitor
Browser: contigD:1174473-1176093+
RNA-seq: read pairs 12354, FPKM 346.1, percentile rank 92.7% (100% = highest expression)
Protein function
| Annotation: | GDI1 | Rab GDP-dissociation inhibitor | |
|---|---|---|---|
| KEGG: | K17255 | GDI1_2 | Rab GDP dissociation inhibitor |
| EGGNOG: | 0PHJ6 | GDI1 | rab gdp-dissociation inhibitor |
| SGD closest match: | S000000938 | GDI1 | Rab GDP-dissociation inhibitor |
| CGD closest match: | CAL0000192989 | GDI1 | Rab GDP dissociation inhibitor |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XEC3_GEOCN | 85.02% | 434 | 0.0 | Rab GDP dissociation inhibitor OS=Geotrichum candidum GN=BN980_GECA12s00560g PE=3 SV=1 |
| MIA_03359_1 | 85.18% | 425 | 0.0 | MIA_03359_1 |
| A0A060T5F2_BLAAD | 76.92% | 442 | 0.0 | Rab GDP dissociation inhibitor OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04994g PE=3 SV=1 |
| A0A1E3PR82_9ASCO | 76.70% | 442 | 0.0 | Rab GDP dissociation inhibitor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_63291 PE=3 SV=1 |
| A0A167ELG9_9ASCO | 77.21% | 430 | 0.0 | Rab GDP dissociation inhibitor OS=Sugiyamaella lignohabitans GN=GDI1 PE=3 SV=1 |
| Q6C3M2_YARLI | 74.38% | 445 | 0.0 | Rab GDP dissociation inhibitor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E33649g PE=3 SV=1 |
| UniRef50_Q96VS9 | 70.81% | 442 | 0.0 | Rab GDP dissociation inhibitor n=5 Tax=Fungi TaxID=4751 RepID=Q96VS9_PICPA |
| A0A1D8PFX8_CANAL | 71.01% | 445 | 0.0 | Rab GDP dissociation inhibitor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GDI1 PE=3 SV=1 |
| A0A1E4TLF0_9ASCO | 69.91% | 442 | 0.0 | Rab GDP dissociation inhibitor OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_89329 PE=3 SV=1 |
| GDI1_YEAST | 65.47% | 446 | 0.0 | Rab GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDI1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0079
Protein family membership
- GDP dissociation inhibitor (IPR018203)
- Rab GDI protein (IPR000806)
Domains and repeats
-
Domain
Detailed signature matches
no IPR
-
-
SSF54373 (FAD-linke...)
Protein sequence
>MCA_05378_1 MDEEYDVIVLGLTECVLSGIMSVEGKKVLHIDRQDHYGGESASLNLTNLYKKFRPSQKPAEALGKDRDWNVDLIPKFVMA GGELTKILTQTDVIPYLEFAQISGSYVYRDGKIAKVPATQMEAIKSSLLGLFEKRRVQTFIEFVGNYKEDQPSTHQGIDL DKNTMTEVYLKFGLQSGTRDFIGHAMALWTTDDYLNKPARETVERIIMYLHSVARYGKSPYIYPLYGLGDLPQAFARLSA VYGGTYMLNTPIDGLEYGEDGKVTGVKSGDKVAKAKIVIGDPTYFPDKVRKTGEKVIRAICILDHPVPNTNDADSLQIII PQNQVKRKHDIYIAVLSSSHCVCSKGHYLAIVSTTIETDQPHIEIEPAFKLLGPRVDTLMGIADIYEPIEDGTKDNVYIS RSYDATSHFETTTDDVKDLYFRITGKPLDIKKRAREDQEE
GO term prediction
Biological Process
GO:0007264 small GTPase mediated signal transduction
GO:0015031 protein transport
GO:0055114 oxidation-reduction process
Molecular Function
GO:0005092 GDP-dissociation inhibitor activity
GO:0005093 Rab GDP-dissociation inhibitor activity
GO:0016491 oxidoreductase activity
Cellular Component
None predicted.