Protein

MCA_05358_2

Length
134 amino acids


Browser: contigD:1121968-1122792+

RNA-seq: read pairs 44167, FPKM 4042.4, percentile rank 99.1% (100% = highest expression)

Protein function

KEGG:K02974RP-S24e small subunit ribosomal protein S24e
EGGNOG:0PPDNFG04476.140S ribosomal protein S24
SGD closest match:S000000876RPS24A40S ribosomal protein S24-A
CGD closest match:CAL0000180342RPS2440S ribosomal protein S24

Protein alignments

%idAln lengthE-value
MIA_03362_182.79%1222e-54MIA_03362_1
A0A0F7RQK0_GEOCN76.74%1293e-5440S ribosomal protein S24 OS=Geotrichum candidum GN=BN980_GECA01s07534g PE=3 SV=1
A0A060T1K4_BLAAD70.54%1298e-5140S ribosomal protein S24 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C17204g PE=3 SV=1
RS24A_YEAST72.73%1327e-5040S ribosomal protein S24-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS24A PE=1 SV=1
UniRef50_P0CX3172.73%1322e-4640S ribosomal protein S24-A n=222 Tax=Eukaryota TaxID=2759 RepID=RS24A_YEAST
Q6C962_YARLI74.59%1227e-4840S ribosomal protein S24 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13728g PE=3 SV=1
A0A1E3PFU9_9ASCO70.49%1228e-4640S ribosomal protein S24 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43309 PE=3 SV=1
Q5A7K0_CANAL74.38%1213e-4540S ribosomal protein S24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS24 PE=3 SV=1
A0A1E4TFR3_9ASCO61.72%1285e-3740S ribosomal protein S24 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107847 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8184
Predicted cleavage: 31

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 134

Detailed signature matches

    1. MF_00545 (Ribosomal...)
    2. PF01282 (Ribosomal_...)
    1. SSF54189 (Ribosomal...)
    1. PS00529 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05358_2
MSETVTIRTRKFISNPLLGRRQFVVDVLHPGSAGVSKDALREKLAGLYKSEKDAVSVFGLKTHFGGGRTTGFGLIYNSPD
DMKKFEPRYRLVRYGLASKVEKPGRQQRRQKRTRQNKIFGTGKREAKRAARKQD

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome