Protein

MCA_05313_1

Length
192 amino acids


Gene name: RSA3

Description: Ribosome assembly protein 3

Browser: contigD:977600-978241+

RNA-seq: read pairs 980, FPKM 62.7, percentile rank 70.2% (100% = highest expression)

Protein function

Annotation:RSA3Ribosome assembly protein 3
EGGNOG:0PS6GRSA3ribosome assembly protein
SGD closest match:S000004211RSA3Ribosome assembly protein 3
CGD closest match:CAL0000175312RSA3Ribosome assembly protein 3

Protein alignments

%idAln lengthE-value
MIA_00246_149.31%1446e-28MIA_00246_1
A0A0J9XF21_GEOCN50.00%941e-23Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA13s03585g PE=4 SV=1
UniRef50_A0A0J9XF2150.00%943e-20Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XF21_GEOCN
A0A1E3PP83_9ASCO53.57%845e-20Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49560 PE=4 SV=1
A0A167CGL8_9ASCO51.61%627e-17Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_4484 PE=4 SV=1
A0A060TAP5_BLAAD37.80%821e-12ARAD1D21384p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D21384g PE=4 SV=1
RSA3_YARLI41.67%722e-10Ribosome assembly protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RSA3 PE=3 SV=1
RSA3_YEAST41.27%631e-09Ribosome assembly protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA3 PE=1 SV=1
A0A1E4T9K7_9ASCO34.25%739e-09Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4556 PE=4 SV=1
RSA3_CANAL35.59%595e-07Ribosome assembly protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RSA3 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6035
Predicted cleavage: 18

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05313_1
MAPRTTDPSKKRRRRRKNARTEDFSSDSSSSSSSSDSSSSEDSSSENEDVDMKTVEPSLKTQQDSANNELTKPKLPEILN
PDEANLLLELPDQYENSIGTNSQANSNEPTKHPKQLLSGDELNPEVKDNKAKFVQHYLALMTENFGDDLIKIRESNDFND
GNMPLLISALKEGVNMFDKEQRDLILSTSKSS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.