Protein
MCA_05303_1
Length
204 amino acids
Gene name: RRS1
Description: Regulator of ribosome biosynthesis
Browser: contigD:948994-949680-
RNA-seq: read pairs 757, FPKM 45.6, percentile rank 63.3% (100% = highest expression)
Protein function
| Annotation: | RRS1 | Regulator of ribosome biosynthesis | |
|---|---|---|---|
| KEGG: | K14852 | RRS1 | regulator of ribosome biosynthesis |
| EGGNOG: | 0PNYS | RRS1 | Ribosome biogenesis protein |
| SGD closest match: | S000005820 | RRS1 | Regulator of ribosome biosynthesis |
| CGD closest match: | CAL0000188560 | RRS1 | Rrs1p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04577_1 | 74.73% | 182 | 3e-71 | MIA_04577_1 |
| A0A1E3PSR2_9ASCO | 62.57% | 179 | 3e-61 | Ribosomal biogenesis regulatory protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81420 PE=4 SV=1 |
| RRS1_YEAST | 60.82% | 171 | 2e-58 | Regulator of ribosome biosynthesis OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRS1 PE=1 SV=1 |
| UniRef50_Q08746 | 60.82% | 171 | 5e-55 | Regulator of ribosome biosynthesis n=96 Tax=Saccharomycetales TaxID=4892 RepID=RRS1_YEAST |
| A0A1D8PCC8_CANAL | 60.56% | 180 | 3e-58 | Rrs1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRS1 PE=4 SV=1 |
| A0A060TEY2_BLAAD | 60.57% | 175 | 1e-55 | ARAD1D11572p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11572g PE=4 SV=1 |
| A0A0J9X344_GEOCN | 63.98% | 186 | 2e-55 | Similar to Saccharomyces cerevisiae YOR294W RRS1 Essential protein that binds ribosomal protein L11 OS=Geotrichum candidum GN=BN980_GECA01s07809g PE=4 SV=1 |
| Q6CH61_YARLI | 58.10% | 179 | 1e-48 | YALI0A12067p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A12067g PE=4 SV=1 |
| A0A1E4TAZ2_9ASCO | 53.85% | 156 | 4e-38 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32366 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0601
Protein family membership
- Ribosomal biogenesis regulatory protein (IPR007023)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05303_1 MSSTEQVIKSVKVEKPIPVEYDFGNLTVFDLNPLDREKLNGTATEKEEHLKEVTRDNIQLLVGQLLQLPIKRTTDSVNSS GKQDSSMAIFTLPPPTTQLPREKSLPKEKPMTKWEKFAKEKGIKKKAKEGKLVYDEESGEWVPKWGYKGINKKMDDQWLV ELPDNPKNPEDDFEDPRKLGRMERKKLVKKNQKQQEKNAKRARS
GO term prediction
Biological Process
GO:0042254 ribosome biogenesis
Molecular Function
None predicted.
Cellular Component
GO:0005634 nucleus