Protein
MCA_05214_1
Length
227 amino acids
Gene name: RET3
Description: Coatomer subunit zeta
Browser: contigD:644039-644723-
RNA-seq: read pairs 2556, FPKM 138.5, percentile rank 83.8% (100% = highest expression)
Protein function
| Annotation: | RET3 | Coatomer subunit zeta | |
|---|---|---|---|
| KEGG: | K20472 | COPZ | coatomer subunit zeta |
| EGGNOG: | 0PJAW | RET3 | Coatomer subunit zeta |
| SGD closest match: | S000005931 | RET3 | Coatomer subunit zeta |
| CGD closest match: | CAL0000177111 | CAALFM_CR03600CA | Coatomer subunit zeta |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A167F0N9_9ASCO | 53.57% | 224 | 7e-74 | Ret3p OS=Sugiyamaella lignohabitans GN=RET3 PE=4 SV=1 |
| MIA_06039_1 | 52.21% | 226 | 2e-72 | MIA_06039_1 |
| A0A1E3PPU7_9ASCO | 46.61% | 221 | 7e-61 | Zeta subunit of the coatomer complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82552 PE=4 SV=1 |
| A0A0J9X5F2_GEOCN | 44.31% | 246 | 5e-60 | Similar to Saccharomyces cerevisiae YPL010W RET3 Zeta subunit of the coatomer complex (COPI), which coats Golgi-derived transport vesicles OS=Geotrichum candidum GN=BN980_GECA03s04916g PE=4 SV=1 |
| UniRef50_A0A0J9X5F2 | 44.31% | 246 | 9e-57 | Similar to Saccharomyces cerevisiae YPL010W RET3 Zeta subunit of the coatomer complex (COPI), which coats Golgi-derived transport vesicles n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5F2_GEOCN |
| A0A060TIG4_BLAAD | 49.34% | 227 | 2e-58 | ARAD1D46332p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46332g PE=4 SV=1 |
| COPZ_YEAST | 39.73% | 219 | 7e-46 | Coatomer subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RET3 PE=1 SV=1 |
| A0A1E4TBE2_9ASCO | 34.82% | 224 | 5e-40 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3712 PE=4 SV=1 |
| Q6C1U7_YARLI | 39.42% | 208 | 2e-38 | YALI0F13255p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F13255g PE=4 SV=1 |
| Q5A006_CANAL | 36.80% | 231 | 2e-35 | Coatomer subunit zeta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR03600CA PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0122
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
227
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05214_1 MGLFDLSLYTVKAVLILDNEGKRVFAKYYTAPHDPSAIPQFNSISKSLETTKKGTSSKTSSNTTHTTSDSASLAASVKEQ KAFEKELFAKTNKQNADILLFNDLCVVAYKQVVDFTIYVVGADLDVNELMLYRLVMSIKDSIYSLFNENVDRRALMENYD QLILVIDEAVDSGIILETDFVNLSERVSKAPANEPILNNIELSEQGLLNVYQFARGKLSEKLRQQFQ
GO term prediction
Biological Process
GO:0006810 transport
Molecular Function
None predicted.
Cellular Component
None predicted.