Protein

MCA_05190_1

Length
276 amino acids


Gene name: VMA8

Description: V-type proton ATPase subunit D

Browser: contigD:584069-585101-

RNA-seq: read pairs 4424, FPKM 197.3, percentile rank 87.8% (100% = highest expression)

Protein function

Annotation:VMA8V-type proton ATPase subunit D
KEGG:K02149ATPeV1D V-type H+-transporting ATPase subunit D
EGGNOG:0PHRZVMA8vacuolar ATP synthase subunit D
SGD closest match:S000000777VMA8V-type proton ATPase subunit D
CGD closest match:CAL0000187911VMA8V-type proton ATPase subunit D

Protein alignments

%idAln lengthE-value
MIA_01228_186.40%2501e-157MIA_01228_1
A0A0J9X398_GEOCN78.70%2772e-151Similar to Saccharomyces cerevisiae YEL051W VMA8 Subunit D of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) OS=Geotrichum candidum GN=BN980_GECA02s02925g PE=3 SV=1
A0A060T8S0_BLAAD74.55%2792e-145ARAD1C31416p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31416g PE=3 SV=1
A0A1E3PEL2_9ASCO85.46%2272e-135Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48076 PE=3 SV=1
Q6CAR5_YARLI69.75%2811e-133YALI0D00583p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D00583g PE=4 SV=1
UniRef50_P3261071.17%2744e-129V-type proton ATPase subunit D n=277 Tax=Fungi TaxID=4751 RepID=VATD_YEAST
VATD_YEAST71.17%2742e-132V-type proton ATPase subunit D OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA8 PE=1 SV=1
A0A1E4TL34_9ASCO84.73%2031e-124Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_85590 PE=3 SV=1
VATD_CANAL80.58%2062e-122V-type proton ATPase subunit D OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA8 PE=3 SV=1
A0A167ELT3_9ASCO75.80%2192e-109H(+)-transporting V1 sector ATPase subunit D OS=Sugiyamaella lignohabitans GN=VMA8 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3137

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. MF_00271 (ATP_synth...)
    2. PF01813 (ATP-synt_D)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05190_1
MSSGARESVFPTRMTLTTMKIKLKGATQGHSLLKRKSEALTKRFRDITRRIDDAKRKMGKVMQTAAFSLAEVSYATGDNI
AYQVQESVKSARIKVRAHQENVSGVYLPQFEAYYDDNSNDFQMTGLGRGGQQVQKAKIVYGKAVETLIELASLQTAFIIL
DEVIKVTNRRVNAIEHVIIPRTENTIKYINSELDELDREEFYRLKKVQDKKQRDSEASEALRKAEKEALIAEEVEKAIQA
GKSVQEATALAEAKAQEETSGEKTAVDQDDDNDVIF

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0042626 ATPase activity, coupled to transmembrane movement of substances

Cellular Component

None predicted.