Protein

MCA_05160_1

Length
313 amino acids


Gene name: MRPL9

Description: 54S ribosomal protein L9, mitochondrial

Browser: contigD:499745-500687-

RNA-seq: read pairs 4435, FPKM 174.5, percentile rank 86.5% (100% = highest expression)

Protein function

Annotation:MRPL954S ribosomal protein L9, mitochondrial
KEGG:K02906RP-L3 large subunit ribosomal protein L3
EGGNOG:0PJBSMRPL9mitochondrial 54S ribosomal protein YmL9
SGD closest match:S000003452MRPL954S ribosomal protein L9, mitochondrial
CGD closest match:CAL0000195020CAALFM_CR00490WAMitochondrial 54S ribosomal protein YmL9

Protein alignments

%idAln lengthE-value
MIA_05422_170.18%2184e-106MIA_05422_1
A0A0J9X8S7_GEOCN61.65%2793e-101Similar to Saccharomyces cerevisiae YGR220C MRPL9 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA04s05741g PE=3 SV=1
A0A167FVR4_9ASCO58.09%2412e-82Mitochondrial 54S ribosomal protein YmL9 OS=Sugiyamaella lignohabitans GN=MRPL9 PE=3 SV=1
A0A060TAH3_BLAAD54.69%2451e-76ARAD1B00264p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00264g PE=3 SV=1
A0A1E3PR40_9ASCO53.56%2392e-76Translation protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72331 PE=3 SV=1
UniRef50_A0A1E3PR4053.56%2395e-73Translation protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PR40_9ASCO
Q6C279_YARLI50.83%2401e-75YALI0F10076p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F10076g PE=3 SV=1
RM09_YEAST49.79%2432e-7054S ribosomal protein L9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL9 PE=1 SV=3
A0A1D8PRP6_CANAL44.90%2458e-61Mitochondrial 54S ribosomal protein YmL9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR00490WA PE=3 SV=1
A0A1E4TIJ7_9ASCO46.69%2421e-58Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29973 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9977
Predicted cleavage: 77

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 313

Detailed signature matches

    1. PF00297 (Ribosomal_L3)
    1. MF_01325_B (Ribosom...)
    1. SSF50447 (Translati...)
    1. PS00474 (RIBOSOMAL_L3)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_05160_1
MASIFISKQILPRSTTTSTTSTTTQLLLSKLQPKVSTRGAAKLTSLSVVSTIPTTTPTLKHSSQAAHARKLLPARTGALA
KKLGMVTWFTPEGQMFPCTVLQVDRCQVTHHKLLEKDGYAAVQVGMEDIPPTKFMNPQTGKLKPNSNKIVSRPLLGHFAR
AQVAPKRHVAEFLVKNDECVKQYPLGQLIEASHFQVGQYVDLKSVSKGKGFQGVMKRHGFHGLGASHGVSLAHRSAGSTG
MNQDPGRVLPGKKMPGHMGVETVTIQNSLVVDVNEKRGLILIKGPVSGPKGAVVRISDAKKKLPEYLGTDAQN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome