Protein

MCA_05149_1

Length
215 amino acids


Gene name: MRPL8

Description: Mitochondrial ribosomal protein of the large subunit

Browser: contigD:473464-474239-

RNA-seq: read pairs 2805, FPKM 160.5, percentile rank 85.6% (100% = highest expression)

Protein function

Annotation:MRPL8Mitochondrial ribosomal protein of the large subunit
EGGNOG:0PNH8FG10077.1mitochondrial 54S ribosomal protein YmL8
SGD closest match:S000003599MRPL854S ribosomal protein L8, mitochondrial
CGD closest match:CAL0000182649MRPL8Mitochondrial 54S ribosomal protein YmL8

Protein alignments

%idAln lengthE-value
MIA_06094_164.29%2101e-83MIA_06094_1
A0A0J9X4E9_GEOCN61.17%2069e-83Similar to Saccharomyces cerevisiae YJL063C MRPL8 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA02s04388g PE=3 SV=1
A0A167FIN5_9ASCO57.39%1762e-70Mitochondrial 54S ribosomal protein YmL8 OS=Sugiyamaella lignohabitans GN=MRPL8 PE=3 SV=1
UniRef50_A0A167FIN557.39%1766e-67Mitochondrial 54S ribosomal protein YmL8 n=10 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FIN5_9ASCO
A0A060T3U6_BLAAD54.73%2014e-67ARAD1C42922p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42922g PE=3 SV=1
A0A1E3PKE4_9ASCO54.07%1724e-59Mitochondrial ribosomal protein of the large subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51910 PE=3 SV=1
A0A1E4T9M3_9ASCO46.95%1643e-38Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_33046 PE=3 SV=1
RM08_YEAST36.41%1954e-3654S ribosomal protein L8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL8 PE=1 SV=4
Q59RQ4_CANAL39.23%1812e-31Mitochondrial 54S ribosomal protein YmL8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPL8 PE=3 SV=1
Q6CE84_YARLI37.21%1727e-31YALI0B17732p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B17732g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8506
Predicted cleavage: 28

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF64263 (Prokaryot...)
    2. PF01196 (Ribosomal_L17)
    3. MF_01368 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05149_1
MPYRKLGRDSSHRKATLRNLVTQLIQFESITTTHAKAKEAQVAAERLIKLAKNRSPTLEAAKVRADQYVYSPKTTINKLF
NELATRYASRPGGFTRVLKLEPRLGDNAPQSILELVDGKRDMKFSLTAKTVARLKSQNLPLDPKLVADIHQVCRYRKNGK
KEFNAEVELMKQRFFSDATVDLSNKPNPKPPKMKSTVTLLENPLLKQKSSSEASS

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome