Protein
MCA_05110_1
Length
79 amino acids
Gene name: COX12
Description: Cytochrome c oxidase subunit 6B
Browser: contigD:380758-381492-
RNA-seq: read pairs 29730, FPKM 4591.8, percentile rank 99.5% (100% = highest expression)
Protein function
| Annotation: | COX12 | Cytochrome c oxidase subunit 6B | |
|---|---|---|---|
| KEGG: | K02267 | COX6B | cytochrome c oxidase subunit 6b |
| EGGNOG: | 0PRAX | COX12 | cytochrome c oxidase polypeptide VIb |
| SGD closest match: | S000004028 | COX12 | Cytochrome c oxidase subunit 6B |
| CGD closest match: | CAL0000174812 | orf19.1082.1 | Cytochrome c oxidase subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X570_GEOCN | 89.87% | 79 | 9e-52 | Cytochrome c oxidase subunit OS=Geotrichum candidum GN=BN980_GECA02s08282g PE=3 SV=1 |
| MIA_04826_1 | 84.81% | 79 | 4e-51 | MIA_04826_1 |
| A0A060T4G6_BLAAD | 75.32% | 77 | 2e-42 | Cytochrome c oxidase subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17182g PE=3 SV=1 |
| A0A1E3PF35_9ASCO | 71.79% | 78 | 6e-40 | Cytochrome c oxidase subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_71591 PE=3 SV=1 |
| COX12_YEAST | 70.13% | 77 | 2e-39 | Cytochrome c oxidase subunit 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX12 PE=1 SV=2 |
| UniRef50_Q01519 | 70.13% | 77 | 5e-36 | Cytochrome c oxidase subunit 6B n=53 Tax=Eukaryota TaxID=2759 RepID=COX12_YEAST |
| Q6C5M8_YARLI | 71.23% | 73 | 6e-37 | Cytochrome c oxidase subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E16709g PE=3 SV=1 |
| A0A1D8PQD5_CANAL | 64.38% | 73 | 2e-34 | Cytochrome c oxidase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1082.1 PE=3 SV=1 |
| A0A1E4TE93_9ASCO | 61.11% | 54 | 4e-23 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23961 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0213
Protein family membership
- Cytochrome c oxidase, subunit VIb (IPR003213)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SSF47694 (Cytochrom...)
-
cd00926 (Cyt_c_Oxid...)
-
PF02297 (COX6B)
-
PIRSF000278 (COX_VIb)
-
no IPR
Unintegrated signatures
-
-
-
PS51808 (CHCH)
Residue annotation
-
Subunit VIb/II int...
-
Subunit VIb/I inte...
-
Subunit VIb/III in...
-
Subunit VIb/VIb in...
-
Subunit VIb/VIa in...
Protein sequence
>MCA_05110_1 MAEDSPLKTVGFDPRYPYQNQTKHCWQSYVDYHKCIKAKGEDFAPCQVFFRTYSSLCPTMWVEKWDDQREAGNFPAKLD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion