Protein
MCA_05092_1
Length
355 amino acids
Gene name: ORC6
Description: Origin recognition complex subunit 6
Browser: contigD:339280-340405-
RNA-seq: read pairs 446, FPKM 15.5, percentile rank 34.8% (100% = highest expression)
Protein function
Annotation: | ORC6 | Origin recognition complex subunit 6 | |
---|---|---|---|
KEGG: | K02608 | ORC6 | origin recognition complex subunit 6 |
EGGNOG: | 0Q0ZN | Origin recognition complex subunit 6 (ORC6) | |
SGD closest match: | S000001160 | ORC6 | Origin recognition complex subunit 6 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03816_1 | 40.30% | 335 | 6e-63 | MIA_03816_1 |
A0A060TCY8_BLAAD | 30.35% | 346 | 4e-51 | ARAD1D46750p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46750g PE=4 SV=1 |
UniRef50_A0A060TCY8 | 30.35% | 346 | 9e-48 | ARAD1D46750p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TCY8_BLAAD |
A0A0J9YHL0_GEOCN | 32.09% | 349 | 2e-49 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s06027g PE=4 SV=1 |
A0A167G096_9ASCO | 29.86% | 365 | 4e-28 | Origin recognition complex subunit 6 OS=Sugiyamaella lignohabitans GN=ORC6 PE=4 SV=1 |
Q6BZQ7_YARLI | 28.40% | 162 | 1e-15 | YALI0F31647p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31647g PE=4 SV=1 |
A0A1E3PEM3_9ASCO | 30.40% | 125 | 2e-14 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83962 PE=4 SV=1 |
ORC6_YEAST | 30.56% | 144 | 2e-08 | Origin recognition complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORC6 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0410
Protein family membership
- Origin recognition complex, subunit 6 (IPR008721)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_05092_1 MSNSTAIPSLKALFPNYAYPFPAELIQATETLTAQSSVGLPLNSTEEAARSMICGLLAFEKLEFKLQEVMPGQVPQIKKT PLPPQKFKELTNVFRQHLFPGEPALPSPSKRRSPRKQASAPIDMSPRKRKRMDDVMTVSPVKSTNSQSTSLYFQPQEMDP DSDMDEPEKKPRGRAARGSKTTVKKATATKGKLAKNRGPGKSDIKEICSYIGVSPQVQDAIIKTYGLYHTLVNDRWGLLA GIIVIIVSKAEPRIIEVGGTYSFYRKLADSANSRGFGVVLDQQKIEDWIKWASHIVNDQTWIKKVTRPDVKPIDLVSTGT KYSSGIGNMISGNMKFNDTTHLEEFENWKKQILSL
GO term prediction
Biological Process
GO:0006260 DNA replication
Molecular Function
GO:0003677 DNA binding
Cellular Component
GO:0005664 nuclear origin of replication recognition complex