Protein

MCA_05084_1

Length
153 amino acids


Gene name: RPS18A

Description: 40S ribosomal protein S18-A

Browser: contigD:328724-329378-

RNA-seq: read pairs 39374, FPKM 3159.1, percentile rank 98.6% (100% = highest expression)

Protein function

Annotation:RPS18A40S ribosomal protein S18-A
KEGG:K02964RP-S18e small subunit ribosomal protein S18e
EGGNOG:0PG18FG06893.140S ribosomal protein S18
SGD closest match:S000002858RPS18A40S ribosomal protein S18-A
CGD closest match:CAL0000197056RPS18Ribosomal 40S subunit protein S18B

Protein alignments

%idAln lengthE-value
MIA_03821_193.51%1542e-102MIA_03821_1
A0A060T5Q2_BLAAD87.58%1539e-98ARAD1B13596p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B13596g PE=3 SV=1
A0A0J9XJ03_GEOCN91.55%1422e-94Similar to Saccharomyces cerevisiae YDR450W RPS18A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA23s00615g PE=3 SV=1
A0A1E3PEN3_9ASCO85.71%1542e-9240S ribosomal protein S18 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28013 PE=3 SV=1
Q6C8D2_YARLI82.55%1495e-91YALI0D20614p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D20614g PE=3 SV=2
A0A1E4TL01_9ASCO82.64%1449e-87Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_12345 PE=3 SV=1
UniRef50_Q5B1Y978.43%1531e-80Ribosomal protein S13p/S18e (AFU_orthologue AFUA_6G13550) n=119 Tax=Eukaryota TaxID=2759 RepID=Q5B1Y9_EMENI
RS18A_YEAST77.08%1443e-8040S ribosomal protein S18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS18A PE=1 SV=1
A0A1D8PQQ5_CANAL76.22%1434e-80Ribosomal 40S subunit protein S18B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS18 PE=3 SV=1
A0A167CTX5_9ASCO85.60%1252e-77Ribosomal 40S subunit protein S18B OS=Sugiyamaella lignohabitans GN=RPS18B PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9693
Predicted cleavage: 43

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 153

Detailed signature matches

    1. PF00416 (Ribosomal_S13)
    2. PS50159 (RIBOSOMAL_...)
    3. MF_01315 (Ribosomal...)
    4. PIRSF002134 (RPS13p...)
    1. SSF46946 (S13-like ...)
    1. PS00646 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05084_1
MPLVITEKGNFQHILRLLGTNVDGKVKIMYALTTIRGVGRRYANLVCKKADVDMAKRAGELTVEELERIVTIIQNPGQYK
IPGWFLNRQRDFTTGKDSHLLVNQLDNKLREDLERLKKIRAHRGLRHQWGFRVRGQHTKTTGRRGKTVSVGKK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome