Protein

MCA_05081_1

Length
119 amino acids


Description: 54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit

Browser: contigD:325228-325718-

RNA-seq: read pairs 1843, FPKM 189.8, percentile rank 87.5% (100% = highest expression)

Protein function

Annotation:54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit
EGGNOG:0PSA7Ribosomal protein L35
SGD closest match:S000005066YNL122C54S ribosomal protein bL35m
CGD closest match:CAL0000186391orf19.6008.4Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_03818_163.30%1096e-40MIA_03818_1
A0A0J9X2W3_GEOCN60.19%1035e-40Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s06016g PE=4 SV=1
UniRef50_A0A0J9X2W360.19%1031e-36Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2W3_GEOCN
A0A060TDC4_BLAAD48.42%951e-20ARAD1D46816p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46816g PE=4 SV=1
A0A1E3PG49_9ASCO45.83%962e-16Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43375 PE=4 SV=1
YNM2_YEAST52.86%702e-1554S ribosomal protein bL35m OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL122C PE=1 SV=1
Q6BZR1_YARLI37.21%867e-07YALI0F31559p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31559g PE=4 SV=1
A0A1D8PCD7_CANAL39.39%664e-06Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6008.4 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9982
Predicted cleavage: 100

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01632 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF143034 (L35p-like)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_05081_1
MLRSTFLASLRPSVNRLTSTTLYTSQAATAVMTPISASLQQSLPPTVSSVRTLLKTHKGAAKRWRKMGNGGFKRGKAGHN
HGNAGWSRNVINNVSGRDYAKGKGEGNHIKKLNRLLPYA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome