Protein
MCA_05081_1
Length
119 amino acids
Description: 54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit
Browser: contigD:325228-325718-
RNA-seq: read pairs 1843, FPKM 189.8, percentile rank 87.5% (100% = highest expression)
Protein function
Annotation: | 54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit | ||
---|---|---|---|
EGGNOG: | 0PSA7 | Ribosomal protein L35 | |
SGD closest match: | S000005066 | YNL122C | 54S ribosomal protein bL35m |
CGD closest match: | CAL0000186391 | orf19.6008.4 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03818_1 | 63.30% | 109 | 6e-40 | MIA_03818_1 |
A0A0J9X2W3_GEOCN | 60.19% | 103 | 5e-40 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s06016g PE=4 SV=1 |
UniRef50_A0A0J9X2W3 | 60.19% | 103 | 1e-36 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2W3_GEOCN |
A0A060TDC4_BLAAD | 48.42% | 95 | 1e-20 | ARAD1D46816p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46816g PE=4 SV=1 |
A0A1E3PG49_9ASCO | 45.83% | 96 | 2e-16 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43375 PE=4 SV=1 |
YNM2_YEAST | 52.86% | 70 | 2e-15 | 54S ribosomal protein bL35m OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL122C PE=1 SV=1 |
Q6BZR1_YARLI | 37.21% | 86 | 7e-07 | YALI0F31559p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31559g PE=4 SV=1 |
A0A1D8PCD7_CANAL | 39.39% | 66 | 4e-06 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6008.4 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9982
Predicted cleavage: 100
Protein family membership
- Ribosomal protein L35 (IPR021137)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01632 (Ribosomal_...)
-

Unintegrated signatures
-
SSF143034 (L35p-like)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05081_1 MLRSTFLASLRPSVNRLTSTTLYTSQAATAVMTPISASLQQSLPPTVSSVRTLLKTHKGAAKRWRKMGNGGFKRGKAGHN HGNAGWSRNVINNVSGRDYAKGKGEGNHIKKLNRLLPYA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome