MCA_05081_1

Description: 54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit

Browser: contigD:325228-325718-

RNA-seq: read pairs 1843, FPKM 189.8, percentile rank 87.5% (100% = highest expression)

Protein function

Annotation:			54S ribosomal protein bL35m; Mitochondrial ribosomal protein of the large subunit
EGGNOG:	0PSA7		Ribosomal protein L35
SGD closest match:	S000005066	YNL122C	54S ribosomal protein bL35m
CGD closest match:	CAL0000186391	orf19.6008.4	Uncharacterized protein

Protein alignments

	%id	Aln length	E-value
MIA_03818_1	63.30%	109	6e-40	MIA_03818_1
A0A0J9X2W3_GEOCN	60.19%	103	5e-40	Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s06016g PE=4 SV=1
UniRef50_A0A0J9X2W3	60.19%	103	1e-36	Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2W3_GEOCN
A0A060TDC4_BLAAD	48.42%	95	1e-20	ARAD1D46816p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46816g PE=4 SV=1
A0A1E3PG49_9ASCO	45.83%	96	2e-16	Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43375 PE=4 SV=1
YNM2_YEAST	52.86%	70	2e-15	54S ribosomal protein bL35m OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL122C PE=1 SV=1
Q6BZR1_YARLI	37.21%	86	7e-07	YALI0F31559p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31559g PE=4 SV=1
A0A1D8PCD7_CANAL	39.39%	66	4e-06	Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6008.4 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9982
Predicted cleavage: 100

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MCA_05081_1
MLRSTFLASLRPSVNRLTSTTLYTSQAATAVMTPISASLQQSLPPTVSSVRTLLKTHKGAAKRWRKMGNGGFKRGKAGHN
HGNAGWSRNVINNVSGRDYAKGKGEGNHIKKLNRLLPYA

GO term prediction