Protein

MCA_05063_1

Length
578 amino acids

Gene name: AGP2B

Description: General amino acid permease AGP2; Plasma membrane regulator of polyamine and carnitine transport

Browser: contigD:269819-271556-

RNA-seq: read pairs 21, FPKM 0.4, percentile rank 6.6% (100% = highest expression)

Protein function

Annotation:AGP2BGeneral amino acid permease AGP2; Plasma membrane regulator of polyamine and carnitine transport
KEGG:K16261YAT yeast amino acid transporter
EGGNOG:0QDKRFG03985.1amino acid
SGD closest match:S000000336AGP2General amino acid permease AGP2
CGD closest match:CAL0000191370AGP2Agp2p

Protein alignments

%idAln lengthE-value
MIA_02440_158.92%5720.0MIA_02440_1
A0A0J9X466_GEOCN60.15%5320.0Similar to Saccharomyces cerevisiae YBR132C AGP2 High affinity polyamine permease OS=Geotrichum candidum GN=BN980_GECA01s07864g PE=4 SV=1
Q6CCP6_YARLI56.08%5510.0YALI0C07678p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C07678g PE=4 SV=1
A0A167CUE2_9ASCO55.30%5570.0Agp2p OS=Sugiyamaella lignohabitans GN=AGP2 PE=4 SV=1
A0A1E3PS52_9ASCO59.56%5020.0Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19230 PE=4 SV=1
A0A1E4TEZ2_9ASCO59.14%5140.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31336 PE=4 SV=1
UniRef50_A0A177D0B557.63%4980.0Putative general amino acid permease n=263 Tax=Fungi TaxID=4751 RepID=A0A177D0B5_9PLEO
AGP2_YEAST47.70%4993e-160General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1
Q5AMG7_CANAL46.81%5495e-158Agp2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AGP2 PE=4 SV=1
A0A060T9M7_BLAAD39.85%5473e-120ARAD1B00352p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00352g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2818

Protein family membership

Domains and repeats

  1. Domain
1 100 200 300 400 500 578

Detailed signature matches

  1. Family IPR002293
    Amino acid/polyamine transporter I
    1. PIRSF006060 (AA_tra...)
  2. Domain IPR004841
    Amino acid permease/ SLC12A domain
    1. PF00324 (AA_permease)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_05063_1
MGFLDKLTRKTTTIVETTSESDIQASKYELNDKKGNAYSEVDEKGPMEEVTSQEEGSITAQSGDHTFRKLKPRHIQLIGI
GGSIGTALFVAIGGTLQKAGPLGLLLAFSTWCIVVLNVTNCSAEMVSYLPIQSPFVALAGRCIDDAFEVMTGWNFFIYQA
FLIPFEITAANSVLHFWIDGYSPAIPISIQLVLYFGINMFAVRMYGESEYWLSMGKVILAIGLMFFTFVVMVGGNPKGDA
FGFRYWKNPGVMNEYNATGDWGRFLGYFAAISTAAYTIAGPEYVSMAAGEAEDPYRVMPKAFKAVFYRLTTFYILGALCV
GILVPYNDPTLATAIDEGRPGAAASPYVIAMTNLNIRVLPHIVNALILTSVFSAGNSFVYCSSRSLYGLALEGKAPKFLT
QCTKSGVPYWTVLVSLGFGCLSFLQLGSEASKVLDWMISVVTASQLINFWAMCLIYYRFWRACNVQGLDRKTFPYFAYFQ
PYSAYIGMFFPFVVCFCSGYAVFLDFDIASFLFSYIMIPVCFFVYLGWKIWFRCPFKKLEEIDLQTGKAEIAKYYESYIP
PPPPKTWYGKVGSWIIGN

GO term prediction

Biological Process

GO:0003333 amino acid transmembrane transport
GO:0006810 transport
GO:0055085 transmembrane transport

Molecular Function

GO:0015171 amino acid transmembrane transporter activity

Cellular Component

GO:0016020 membrane