Protein

MCA_05033_1

Length
222 amino acids


Gene name: VPS20

Description: Vacuolar protein sorting-associated protein 20

Browser: contigD:186180-186849+

RNA-seq: read pairs 567, FPKM 31.4, percentile rank 53.9% (100% = highest expression)

Protein function

Annotation:VPS20Vacuolar protein sorting-associated protein 20
KEGG:K12195CHMP6 charged multivesicular body protein 6
EGGNOG:0PPFVVPS20Charged multivesicular body protein
SGD closest match:S000004682VPS20Vacuolar protein sorting-associated protein 20
CGD closest match:CAL0000174239VPS20ESCRT-III subunit protein

Protein alignments

%idAln lengthE-value
MIA_04829_149.46%1861e-43MIA_04829_1
A0A060SZ63_BLAAD55.78%1472e-42ARAD1A17908p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17908g PE=3 SV=1
A0A0J9X658_GEOCN51.59%1573e-42Similar to Saccharomyces cerevisiae YMR077C VPS20 Myristoylated subunit of ESCRTIII, the endosomal sorting complex required for transport of transmembrane proteins into the multivesicular body pathway OS=Geotrichum candidum GN=BN980_GECA02s08326g PE=3 SV=1
A0A167D3A5_9ASCO54.55%1541e-40ESCRT-III subunit protein VPS20 OS=Sugiyamaella lignohabitans GN=VPS20 PE=3 SV=1
UniRef50_A0A1X2I6E949.68%1553e-34Snf7 family n=5 Tax=Fungi TaxID=4751 RepID=A0A1X2I6E9_9FUNG
Q6C0V9_YARLI53.25%1541e-36YALI0F21307p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F21307g PE=3 SV=1
A0A1E3PF96_9ASCO42.13%1971e-36SNF7 family protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84032 PE=3 SV=1
A0A1E4TIL5_9ASCO45.71%1409e-32Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15288 PE=4 SV=1
Q5AH99_CANAL33.66%2029e-19ESCRT-III subunit protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS20 PE=3 SV=1
VPS20_YEAST33.33%1623e-15Vacuolar protein sorting-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS20 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0631

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF03357 (Snf7)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05033_1
MGNSTSKSPSVSKQDEAVLQLKLQRDSLKRYKKRITVIIEREHQVAKQCLQNGDKKRALLALKKKKYQENQVEELEKQMT
TLEELTQSVEFAQLQQSFFKSLQQGNNILKELNKELSIEKVEKLLDDSSESIAYQNELNEMLSKNINPEDEMDVLEELEQ
MEKEELNKNQLPDIHNKTKSSEDLQNAMPKVPKTKLPDVPTKKQEQQPEEEEDTKEKQMMAA

GO term prediction

Biological Process

GO:0007034 vacuolar transport

Molecular Function

None predicted.

Cellular Component

None predicted.