Protein
MCA_05019_1
Length
629 amino acids
Gene name: ARP6
Description: Actin-like protein ARP6
Browser: contigD:125045-126999+
RNA-seq: read pairs 1103, FPKM 21.6, percentile rank 43.4% (100% = highest expression)
Protein function
Annotation: | ARP6 | Actin-like protein ARP6 | |
---|---|---|---|
KEGG: | K11662 | ACTR6 | actin-related protein 6 |
EGGNOG: | 0PI18 | ARP6 | Component of the SWR1 complex which mediates the ATP- dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in chromosome stability |
SGD closest match: | S000004075 | ARP6 | Actin-like protein ARP6 |
CGD closest match: | CAL0000174064 | ARP6 | Actin-like protein ARP6 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04718_1 | 49.66% | 596 | 0.0 | MIA_04718_1 |
A0A0J9X7U0_GEOCN | 45.43% | 372 | 1e-102 | Similar to Saccharomyces cerevisiae YLR085C ARP6 Actin-related protein that binds nucleosomes OS=Geotrichum candidum GN=BN980_GECA05s02969g PE=3 SV=1 |
UniRef50_A0A0J9X7U0 | 45.43% | 372 | 2e-99 | Similar to Saccharomyces cerevisiae YLR085C ARP6 Actin-related protein that binds nucleosomes n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7U0_GEOCN |
A0A167ERS4_9ASCO | 49.30% | 286 | 7e-89 | Arp6p OS=Sugiyamaella lignohabitans GN=ARP6 PE=3 SV=1 |
A0A060TA56_BLAAD | 48.97% | 292 | 6e-88 | ARAD1B04862p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04862g PE=3 SV=1 |
A0A1E3PJI2_9ASCO | 27.84% | 582 | 1e-78 | Actin-like protein ARP6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25859 PE=3 SV=1 |
ARP6_YARLI | 33.99% | 353 | 3e-63 | Actin-like protein ARP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP6 PE=3 SV=1 |
ARP6_CANAL | 36.24% | 298 | 2e-48 | Actin-like protein ARP6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARP6 PE=3 SV=1 |
A0A1E4THI9_9ASCO | 35.71% | 266 | 2e-46 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_51969 PE=3 SV=1 |
ARP6_YEAST | 38.55% | 262 | 2e-45 | Actin-like protein ARP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1230
Protein family membership
- Actin family (IPR004000)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
-
SSF53067 (Actin-lik...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05019_1 MSKVLVIDNGSYNIKIGYASDATPKSGPFLIPNCIIHGKNKRSYIGSQFSNCVDYSGLAFQRPHDKGQLVDWRLEYAIWN YAFYSGDSPISVDPSETSLILTEAPMSLPTISANTDQMIFEEYGFESYYRCTPGSLVPWNDFDTDLFPSTATTPKSRSTS ISTPAVVDSASRSVSPSGGKSSQSPDKHHPLAECALVIDSGFNCTNIMPTILGEVYWPAVQQVSVGGRLLTNYLRETLSF RHYNMMEDTYLVNLIKESSCFVSKDFDKDLDYCYDASQNRRKKKKFKSEPAEPKDTPKQNKTRSLTDWQRRQLEKRVKLG QFNDPPFSVKYVLPENSAELGYILDEGKERDISEYEEEYIKYLDEYGGDDEEVEEYENDKVTVSEPTSGTPNTIIEAKTE APSTSMFPTTSATRSSVLSSVSNIPDQQILKLSTERFSIPEVLFSPHLVGLDQAGISEAIMTSISKVPQELQSLFLANIV VVGGNSNLPGFVERIRHDLTSMIPSIYDYDVLEKRKFQNDSSYGFSGGKGILRVAKPRSNPDTYSWFGGARLGLQPEMLA KVHVTKQDYMEYGESLCASKFNPKRGGAGISGRPDETDAADSNSNKHRHGIYEEYDEDEEEEDSDGIYY
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.