Protein
MCA_05001_1
Length
286 amino acids
Gene name: ATP3
Description: ATP synthase subunit gamma, mitochondrial
Browser: contigD:60952-62353+
RNA-seq: read pairs 43584, FPKM 1876.4, percentile rank 97.7% (100% = highest expression)
Protein function
| Annotation: | ATP3 | ATP synthase subunit gamma, mitochondrial | |
|---|---|---|---|
| KEGG: | K02136 | ATPeF1G | F-type H+-transporting ATPase subunit gamma |
| EGGNOG: | 0PH2F | ATP3 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits |
| SGD closest match: | S000000243 | ATP3 | ATP synthase subunit gamma, mitochondrial |
| CGD closest match: | CAL0000177710 | ATP3 | ATP synthase subunit gamma |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04722_1 | 82.58% | 287 | 7e-175 | MIA_04722_1 |
| A0A0J9XG08_GEOCN | 81.47% | 286 | 8e-173 | ATP synthase subunit gamma OS=Geotrichum candidum GN=BN980_GECA14s01572g PE=3 SV=1 |
| A0A060T825_BLAAD | 70.28% | 286 | 1e-149 | ATP synthase subunit gamma OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32956g PE=3 SV=1 |
| A0A1E3PPT9_9ASCO | 68.06% | 288 | 8e-141 | ATP synthase subunit gamma OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45454 PE=3 SV=1 |
| A0A167DUD8_9ASCO | 72.95% | 244 | 1e-132 | ATP synthase subunit gamma OS=Sugiyamaella lignohabitans GN=ATP3 PE=3 SV=1 |
| UniRef50_A0A167DUD8 | 72.95% | 244 | 3e-129 | ATP synthase subunit gamma n=46 Tax=Fungi TaxID=4751 RepID=A0A167DUD8_9ASCO |
| Q6C338_YARLI | 64.51% | 293 | 1e-129 | ATP synthase subunit gamma OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02893g PE=1 SV=2 |
| A0A1D8PRY3_CANAL | 58.25% | 297 | 3e-112 | ATP synthase subunit gamma OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP3 PE=3 SV=1 |
| ATPG_YEAST | 57.50% | 280 | 2e-105 | ATP synthase subunit gamma, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP3 PE=1 SV=1 |
| A0A1E4TCW2_9ASCO | 57.14% | 252 | 2e-97 | ATP synthase subunit gamma OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32806 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9632
Predicted cleavage: 19
Protein family membership
- ATP synthase, F1 complex, gamma subunit (IPR000131)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00153 (ATPASE_GAMMA)
-
no IPR
Unintegrated signatures
-
-
-
PIRSF039089 (ATP_sy...)
Residue annotation
-
core domain interf...
-
delta subunit inte...
-
epsilon subunit in...
Protein sequence
>MCA_05001_1 MFALRTGVTTVKASTRSYATLREIETRLKSIKNIEKITNTMKIVASTRLGKAQRAMAVSRVFGSATKQVFDSAETAVPAE APKKLLIAMTSDKGLCGSIHSQLARHVRSVLASSPETEVVAVGDKVKTQIARSYPNNIVASFASIGKEAPTFNEAAAIAD KIISLGKEYDSIEIVYNKFISGVAFEPSTLNVFTLPAIEASPKISSFELEDEVLGNLSEYSLASYILWGLAEGHASEISA RRNAMDNASKNASDMIGKYSILYNRTRQAVITNELVDIITGASSLE
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)