Protein

MCA_04998_1

Length
134 amino acids

Gene name: HTZ1

Description: Histone H2A.Z

Browser: contigD:57444-58021+

RNA-seq: read pairs 1307, FPKM 119.6, percentile rank 81.8% (100% = highest expression)

Protein function

Annotation:HTZ1Histone H2A.Z
KEGG:K11251H2A histone H2A
EGGNOG:0PNUWHTZ1Variant histone H2A which can replace H2A in some nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. This variant is enriched at promoters, it may keep them in a repressed state until the appropriate activation signal is received. Near telomeres, it may counteract gene silencing caused by the spread of heterochromatin proteins. Required for the RNA polymerase II and SPT15 TBP recruitment to the target genes. Involved in chromosome stability
SGD closest match:S000005372HTZ1Histone H2A.Z
CGD closest match:CAL0000185932HTZ1Histone H2A.Z

Protein alignments

%idAln lengthE-value
MIA_04725_189.62%1068e-64MIA_04725_1
A0A0J9XFD7_GEOCN87.74%1063e-63Histone H2A OS=Geotrichum candidum GN=BN980_GECA13s01891g PE=3 SV=1
H2AZ_CANAL81.13%1062e-61Histone H2A.Z OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTZ1 PE=3 SV=3
A0A060T2Z3_BLAAD89.69%978e-61Histone H2A OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32890g PE=3 SV=1
A0A167DUA0_9ASCO88.89%991e-60Histone H2A OS=Sugiyamaella lignohabitans GN=HTZ1 PE=3 SV=1
H2AZ_YARLI81.13%1062e-60Histone H2A.Z OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTZ1 PE=3 SV=1
UniRef50_Q6BQE979.25%1062e-57Histone H2A.Z n=59 Tax=Eukaryota TaxID=2759 RepID=H2AZ_DEBHA
A0A1E3PPF3_9ASCO84.47%1031e-58Histone H2A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81833 PE=3 SV=1
A0A1E4TAX1_9ASCO81.00%1003e-56Histone H2A OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3442 PE=3 SV=1
H2AZ_YEAST84.04%946e-53Histone H2A.Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTZ1 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0345

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 134

Detailed signature matches

  1. Family IPR002119
    Histone H2A
    1. PR00620 (HISTONEH2A)
    2. SM00414 (h2a4)
  2. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
  3. Domain IPR007125
    Histone H2A/H2B/H3
    1. PF00125 (Histone)
  4. Domain IPR032454
    Histone H2A, C-terminal domain
    1. PF16211 (Histone_H2A_C)
  5. SITE IPR032458
    Histone H2A conserved site
    1. PS00046 (HISTONE_H2A)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.20.10
  2. cd00074 (H2A)
  3. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. homodimerization i...
  3. H2A-H2B dimerizati...

Protein sequence

>MCA_04998_1
MSGGKGKSGGKGKDSTVDRTSISHSARAGLQFPVGRVRRYLKRSVQNRVRVGAKAAIYITAVLEYLTAEVLELAGNAARD
LGVKRITPRHLQLAIRGDEELDTLVRATIAFGGVLPHINKVLLLKAEKKKPKLK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity

Cellular Component

GO:0000786 nucleosome
GO:0005634 nucleus