Protein

MCA_04983_1

Length
228 amino acids

Gene name: HOP1

Description: Meiosis-specific protein Hop1; in S. cerevisiae required for chromosome synapsis

Browser: contigD:29853-30617+

RNA-seq: read pairs 2, FPKM 0.1, percentile rank 3.7% (100% = highest expression)

Protein function

Annotation:HOP1Meiosis-specific protein Hop1; in S. cerevisiae required for chromosome synapsis
EGGNOG:0PM3THOP1meiosis specific protein Hop1
SGD closest match:S000001334HOP1Meiosis-specific protein HOP1

Protein alignments

%idAln lengthE-value
MIA_05417_138.53%2313e-37MIA_05417_1
UniRef50_A0A1E3P98738.24%1361e-19Uncharacterized protein (Fragment) n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3P987_WICAO
A0A1E3PII4_9ASCO39.67%1212e-21DNA-binding protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_12777 PE=4 SV=1
HOP1_YEAST33.83%1331e-14Meiosis-specific protein HOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOP1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2583

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 228

Detailed signature matches

  1. Domain IPR003511
    HORMA domain
    1. PF02301 (HORMA)
    2. PS50815 (HORMA)
    3. SSF56019 (The spind...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.90...

Protein sequence

>MCA_04983_1
MEQLLRAKNLKKQEKIISKPSQKTYISLKSSVNSNSRYIGHPTHLQQQQQHNFQKESSINNLSNSINQEYSLELVKDTIS
ASFGALAFLRGFFSDENFEDDVVSPPNLKVTSQNDHPLKLIRNKPLNIKRLKRGITPEADTLIDWITIGAFDALEKGYLK
NIIFSIFSNENDEADFIEAYSFSFVYSANKTVKMDFSFQNNKQPTVENISATYTGKRFCNMTSSMMTY

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.