Protein
MCA_04968_1
Length
75 amino acids
Gene name: NOP10
Description: H/ACA ribonucleoprotein complex subunit 3
Browser: contigC:4534365-4534699-
RNA-seq: read pairs 2810, FPKM 456.8, percentile rank 94.0% (100% = highest expression)
Protein function
Annotation: | NOP10 | H/ACA ribonucleoprotein complex subunit 3 | |
---|---|---|---|
KEGG: | K11130 | NOP10 | H/ACA ribonucleoprotein complex subunit 3 |
EGGNOG: | 0PRU4 | NOP10 | H ACA ribonucleoprotein complex subunit 3 |
SGD closest match: | S000007455 | NOP10 | H/ACA ribonucleoprotein complex subunit 3 |
CGD closest match: | CAL0000195074 | NOP10 | snoRNP complex protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
NOP10_YEAST | 93.10% | 58 | 5e-35 | H/ACA ribonucleoprotein complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP10 PE=1 SV=1 |
UniRef50_Q6Q547 | 93.10% | 58 | 1e-31 | H/ACA ribonucleoprotein complex subunit 3 n=158 Tax=Eukaryota TaxID=2759 RepID=NOP10_YEAST |
Q6CDG6_YARLI | 89.66% | 58 | 6e-34 | YALI0C00693p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C00693g PE=4 SV=1 |
A0A0J9XIA8_GEOCN | 87.93% | 58 | 4e-34 | Similar to Saccharomyces cerevisiae YHR072W-A NOP10 Constituent of small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs OS=Geotrichum candidum GN=BN980_GECA18s01627g PE=4 SV=1 |
A0A1D8PTN4_CANAL | 88.14% | 59 | 8e-34 | snoRNP complex protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP10 PE=4 SV=1 |
MIA_03756_1 | 87.93% | 58 | 2e-33 | MIA_03756_1 |
A0A1E3PL62_9ASCO | 88.14% | 59 | 5e-33 | H/ACA ribonucleo protein complex subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51430 PE=4 SV=1 |
A0A060T6Y7_BLAAD | 86.21% | 58 | 7e-33 | ARAD1C24442p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C24442g PE=4 SV=1 |
A0A1E4TDC6_9ASCO | 79.31% | 58 | 5e-29 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_143344 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0318
Protein family membership
- H/ACA ribonucleoprotein complex, subunit Nop10 (IPR007264)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Protein sequence
>MCA_04968_1 MHLMYTLGEDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLLPTQTTLDSLLKISFKQRFCI
GO term prediction
Biological Process
GO:0001522 pseudouridine synthesis
GO:0042254 ribosome biogenesis
Molecular Function
GO:0030515 snoRNA binding
Cellular Component
None predicted.