Protein

MCA_04937_1

Length
429 amino acids

Gene name: RML2

Description: 54S ribosomal protein RML2, mitochondrial

Browser: contigC:4472154-4473444+

RNA-seq: read pairs 6957, FPKM 199.9, percentile rank 88.0% (100% = highest expression)

Protein function

Annotation:RML254S ribosomal protein RML2, mitochondrial
EGGNOG:0PFKQFG01290.1mitochondrial 54S ribosomal protein RML2
SGD closest match:S000000776RML254S ribosomal protein RML2, mitochondrial
CGD closest match:CAL0000181892orf19.5420Mitochondrial 54S ribosomal protein RML2

Protein alignments

%idAln lengthE-value
MIA_04394_169.52%4200.0MIA_04394_1
A0A0J9X3Z5_GEOCN72.30%3613e-170Similar to Saccharomyces cerevisiae YEL050C RML2 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA02s01902g PE=4 SV=1
A0A060T2U7_BLAAD66.01%3534e-151ARAD1C31548p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31548g PE=4 SV=1
A0A167EWC7_9ASCO64.25%3725e-151Mitochondrial 54S ribosomal protein RML2 OS=Sugiyamaella lignohabitans GN=RML2 PE=4 SV=1
RML2_YEAST66.57%3353e-13654S ribosomal protein RML2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RML2 PE=1 SV=1
UniRef50_P3261166.57%3357e-13354S ribosomal protein RML2, mitochondrial n=59 Tax=Opisthokonta TaxID=33154 RepID=RML2_YEAST
A0A1E3PKY1_9ASCO57.88%3496e-120Mitochondrial ribosomal protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24090 PE=4 SV=1
Q6C9B0_YARLI56.32%3648e-112YALI0D12606p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12606g PE=4 SV=1
A0A1E4TDN7_9ASCO62.37%2871e-108Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23992 PE=4 SV=1
Q5A7P6_CANAL52.82%2842e-88Mitochondrial 54S ribosomal protein RML2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5420 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9946
Predicted cleavage: 38

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 429

Detailed signature matches

  1. Family IPR002171
    Ribosomal protein L2
    1. SM01383 (Ribosomal_...)
  2. Family IPR005880
    Ribosomal protein L2, bacterial/organellar-type
    1. TIGR01171
  3. Domain IPR012340
    Nucleic acid-binding, OB-fold
    1. SSF50249 (Nucleic a...)
  4. Domain IPR022666
    Ribosomal Proteins L2, RNA binding domain
    1. PF00181 (Ribosomal_L2)
  5. Domain IPR014722
    Ribosomal protein L2 domain 2
    1. G3DSA:2.30.30.30
  6. Domain IPR008991
    Translation protein SH3-like domain
    1. SSF50104 (Translati...)
  7. Domain IPR022669
    Ribosomal protein L2, C-terminal
    1. PF03947 (Ribosomal_...)
    2. SM01382 (Ribosomal_...)
  8. Domain IPR014726
    Ribosomal protein L2, domain 3
    1. G3DSA:4.10.95...
  9. SITE IPR022671
    Ribosomal protein L2, conserved site
    1. PS00467 (RIBOSOMAL_L2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.40.50...
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. mobidb-lite (disord...)

Protein sequence

>MCA_04937_1
MSGLLTTFTSSVRWASRQSVLSSKLTIRSLSTGKTLMASESFTNPADQQETSKLISETLHASEGRKKSRPTAKRPKESID
ANAIFEEFKSLEIVPLGKQINQNELEKHDEDLKRRLKLSKAAVQMKRIKPYSPSLRWYRAPIYPYLHKGKPIRALTIPKK
KHSGRNNSGKITVRHRGGGHKRRIRLVDFFRMESGPHVVVRIEYDPGRTGHIALLENPATKGLSYILACEGLRAGDVVQS
FRSGIPQDIIDSMGGNPDPAMLAARTAQRGNCLPLSMIPLGTVIHNIGITANGPGKFCRAAGTYGRIFEKHPETGKAVVR
LKSGEYRYVALNACATIGMVSNPSHQHASLGKAGRSRNMGIRPTVRGVAMNKTEHPHGGGRGKSKSKKISMSKWGVKAKS
GFKTRRGKNINHMLVRDRPRGKDKRGGSV

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0016740 transferase activity

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit